SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000022974 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000022974
Domain Number 1 Region: 19-78
Classification Level Classification E-value
Superfamily BPTI-like 5.53e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 
Domain Number 2 Region: 80-140
Classification Level Classification E-value
Superfamily BPTI-like 1.28e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 
Domain Number 3 Region: 144-187
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000596
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000022974   Gene: ENSTNIG00000019726   Transcript: ENSTNIT00000023216
Sequence length 190
Comment pep:novel chromosome:TETRAODON8:Un_random:97805719:97806772:1 gene:ENSTNIG00000019726 transcript:ENSTNIT00000023216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFYALAAFALFSSFCNVLALAPKAVCLLQVNEGPCRGDIERYYYNTITQKCELFSYGGC
QGNANNFRSFQECQKTCFRIPKIPQICRFPQEVGPCRALLRKYFFNMTTMQCEPFYYGGC
LGSSNRFDDLASCKEYCSPHKSLPVLCLDPLDKGKCSASFPRYYYNKATKKCEEFIYSGC
GGNSKNFVLM
Download sequence
Identical sequences Q4RDL7
ENSTNIP00000022974 99883.ENSTNIP00000022974 ENSTNIP00000022974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]