SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000023033 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000023033
Domain Number 1 Region: 483-663
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-49
Family SPRY domain 0.00062
Further Details:      
 
Domain Number 2 Region: 169-232
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.21e-17
Family B-box zinc-binding domain 0.0000486
Further Details:      
 
Domain Number 3 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000202
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 4 Region: 381-488
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000864
Family Fibronectin type III 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000023033
Domain Number - Region: 118-163
Classification Level Classification E-value
Superfamily RING/U-box 0.00265
Family ZZ domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000023033   Gene: ENSTNIG00000013963   Transcript: ENSTNIT00000023275
Sequence length 672
Comment pep:novel chromosome:TETRAODON8:2:12739218:12748109:1 gene:ENSTNIG00000013963 transcript:ENSTNIT00000023275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCTPSEPIQSITAFQCPTCR
YVITLNQRGLEGLKRNVTLQNIIDRYQKASRSGPNSPKETRREGAVPYSGAMTSPGDRVQ
CQFCEQDPPQDAVKTCITCEVSYCDECLKATHPNKKPFTGHRLIEPLLDSHLRGIMCVEH
EDEKVNMYCVTDEQLICALCKLVGRHRDHHVAALGDRYDKLKESLETNLNNLIKRTSDLE
SLMGKLIQTCQHVEVNASRQENKLLEECDLLITIIQQRRQIITTKIKEGKAVRLRKLAQQ
IAGCKQCIERSSSLIAQAEQALKEADHTRFLQTAKSICERVSMATASSQVLLPEINLNDN
FDTFALDFTREKKMLENLDYLTANAAPNPPVIREELCTASCDTITVHWTSEDEFTVVSYE
LQYAIFTSQSNVVSLCSSADSWMIVPNIKQNHYTVHGLQCGTKYIFIVKAINQAGNRSSE
TAKLKTNSQPFRLDPKSAHRKLRVSHDNLTVERDETSAKKSHSQDRFTSHSSYGVTGNVY
IDSGRHYWEALIGGSTWFAVGIAYKTAPRHEWVGKNSASWVLSRCNNSWVARHNSKEMPV
EPSPHLRRLGILLDYDSGSLSFYDAVGSQHLYTFDIAFAQPVCPVFNVWNRCLTILTGLP
IPDHLEGTDYKA
Download sequence
Identical sequences H3DR84
ENSTNIP00000023033 99883.ENSTNIP00000023033 ENSTNIP00000023033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]