SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000023097 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000023097
Domain Number 1 Region: 11-56
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 0.0000000000000131
Family Assembly domain of cartilage oligomeric matrix protein 0.0027
Further Details:      
 
Domain Number 2 Region: 95-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000141
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000023097   Gene: ENSTNIG00000019828   Transcript: ENSTNIT00000023339
Sequence length 160
Comment pep:novel chromosome:TETRAODON8:Un_random:105936545:105937500:1 gene:ENSTNIG00000019828 transcript:ENSTNIT00000023339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNGDVGSLLGGDHTKALIGQLIIFNQILGELRLDIREQVKEMALIRNSILECQVCGFHEP
RSRCSPNPCYKGVACLESLQYPGFTCGACPPGTSGNGTHCEDIDECSLQPCFSPEACVNT
VGGFSCRPCPPGLWGAPLAGTGLDAKTHRQECVDVDECVE
Download sequence
Identical sequences H3DRE7
ENSTNIP00000023097 99883.ENSTNIP00000023097 ENSTNIP00000023097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]