SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000473 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000473
Domain Number 1 Region: 645-840
Classification Level Classification E-value
Superfamily Sec7 domain 4.84e-76
Family Sec7 domain 0.00000188
Further Details:      
 
Domain Number 2 Region: 280-313,372-585,1140-1489
Classification Level Classification E-value
Superfamily ARM repeat 1.63e-28
Family Armadillo repeat 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000473   Gene: ENSTNIG00000010109   Transcript: ENSTNIT00000004091
Sequence length 1811
Comment pep:novel chromosome:TETRAODON8:6:3329568:3345472:1 gene:ENSTNIG00000010109 transcript:ENSTNIT00000004091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEIKEESKKLSPTSGDAKSSSSTLPPIKSKANFIEADKYFLPFELACQSKCPRIVITSLD
CLQKLIAYGHLTGSAPDSTAPGKKLIDRIIETICACFQGPQTDEGVQLQIIKALLTAVTS
QHIEIHEGTVLQAVRTCYNIYLASKNLINQTTAKATLTQMLNVIFARMENQALQEAKQLE
RERHRQHSPVTQHTDTESPTLQTHSNPPNRAASQGQEGRGEQAEQEEQGPVYENPDPENG
SHYCVPENEQTEADQALAARETVEDEDEEAPNYEEKAQEIVQSILQDVVNTVAGAEAEPE
PAEAATDGVQNCIEDESTLGSDGEHVHANGIPGTPISATFTPSLPDDRLSVSSNDTQESG
VAPGQPPGAKFSHILQKDAFLVFRSLCKLSMKPLSDGPPDPKSHELRSKVLSLQLLLSIL
QNAGPIFKTNEMFINAIKQYLCVALSKNGVSSVPEVFELSLSIFLTLLSHFKTHLKMQIE
VFFKEIFLYILETSTSSYEHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERLVN
DLSKIAQGRAGHELGTTPLQELTLRKKGLECLVSILKCMVEWSKDQYVNPNSQTSLGQEK
PSEQENTDTKAPETINRYGSINSLDSTASSGIGSYSTQMSGTDNPEQFEVLKQQKEIIEQ
GIDLFNKKPKRGIQYLQEQGMLGTTPEDLAQFLHQEERLDSTQVGEFLGDNDRFNKEVMY
AYVDQMDFQGKDFVSALRMFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTA
YVLAYSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSAIYDEIAGKKIAM
KETKELTMKSNKQSVASEKQRRLLYNVEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVR
PMFKLAWTPFLAAFSVGLQDCDDTEVASLCLEGIRCAIRIACIFSIQLERDAYVQALARF
TLLTASSGITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEIMKCISQLELAQLIGTGVKA
RYISGTVRGKEGFITSTKEQNNDEYLGLVGGTVDRKQIASIQESIGETSSQSVVVAVDRI
FTGSTRLDGNAIVDFVRWLCAVSMDELASPTHPRMFSLQKIVEISYYNMGRIRLQWSRIW
EVIGDHFNKVGCNSNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNR
SPTIRDMVVRCIAQMVNSQAANIRSGWKNIFSVFHLAASDQDESIVELAFQTTGHIVTNV
FEKHFAATIDSFQDAVKCLSEFACNASFPDTSMEAIRLIRHCAKYVSDRPQAFKDYTSDD
MNVATEDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEVMKTYGHTFEKHWWQDLF
RIVFRIFDNMKLPEQQTEKAEWMTTTCNHALYAICDVFTQYFEALNDVLLDDILAQLYWC
VQQDNEQLARSGTNCLENVVILNGEKFSPETWDKTCNCMLDIFITTIPHALLTWRPAGAE
GEHVTTQALSDKQLDSISQKSLDIQSRSDDQHSISSADRSTTDNHRQSHYSSGSGVGEDG
SRSRTPTKVPEHRLFAALLIKCVVQLELIQTIDNIVFFPATSKKEDAENFAAAQRDASHV
ADLPAETQDQGMYRYLTSQQLFKLLDCLLESHRFAKAFNSNNEQRTLLWKAGFKGKSKPN
LLKQETSSLACGLRILFRMYTDESRQDAWEEVQRRLLNVCSEAVAYFLALTSESHREAWT
NLLLLFLTKVLKISDERFKAHASRYYSLLCEIMQLDLIPELRAVLRKFYLRIGAVFHIAQ
LPEAEPDRPAS
Download sequence
Identical sequences H3BWW0
99883.ENSTNIP00000000473 ENSTNIP00000000473 ENSTNIP00000000473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]