SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000537 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000537
Domain Number 1 Region: 230-291
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0043
Further Details:      
 
Domain Number 2 Region: 370-425
Classification Level Classification E-value
Superfamily BPTI-like 1.31e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0026
Further Details:      
 
Domain Number 3 Region: 316-353
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000011
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 142-233
Classification Level Classification E-value
Superfamily PKD domain 0.000000445
Family PKD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000537   Gene: ENSTNIG00000000552   Transcript: ENSTNIT00000003132
Sequence length 508
Comment pep:novel chromosome:TETRAODON8:10:4240619:4245046:1 gene:ENSTNIG00000000552 transcript:ENSTNIT00000003132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLLGARLGARCLLVAALLLHSSLGQEVGDGCLADFQKGKDDFILDTDESVKDGATFLS
SPNLGRYRDCVGACCKEPKCNVAFMERGEEEGSISSCFLFDCLYKMKYACRFVKKKGFSS
YIQDTLYESYLSVDQAPHSQDRPPVANGGQDRVVQPQDIVMLNGVQSKDDKAIVSYQWQM
LTSYPYAIIEKTNFKDQIMVSNLTSGVYKFQLTVTDTIGQSDSVKVTVMVLTPEQSDHHC
MAPMKVGPCRGSFPRWHYNAASQKCEAFTFGGCRENLNNYLSEDECNKACSGSEKSSKTG
RALPLPGDQVEKCNTPCTTEEFTCDNGCCLDPGLECDSTPQCSDGSDERKCDDLNNTFNR
LLQIPVNEQKMRCTELPDTGSCRDSLTKWYYNPVKQECSRFNYGGCQGNENRFETQDSCA
KFCRGITEKDVFARIEEFERTTATSNTVVVVIAALLGLAIFILLAILLYCLVKGRRKSGQ
HQRVPANTIPVTFEDRERLVYNTTTKPI
Download sequence
Identical sequences H3BX24
ENSTNIP00000000537 99883.ENSTNIP00000000537 ENSTNIP00000000537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]