SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000808 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000000808
Domain Number - Region: 22-77
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0253
Family Laminin G-like module 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000808   Gene: ENSTNIG00000010867   Transcript: ENSTNIT00000002703
Sequence length 359
Comment pep:novel chromosome:TETRAODON8:Un_random:25333593:25343372:1 gene:ENSTNIG00000010867 transcript:ENSTNIT00000002703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IARQRIPYRLGRVVDEWLLDKGRQLTIFNSQAFIKIGGGGEKGRHFQGQISGLYYNGLQV
LKLAAEGDPNVQTQGNLRLVGDVPSVLTTDTTSTTPLADMSTTIMETTTTMATTTTRKQR
SPTMRDSVTQNADDLLVASAECPSDDEDLEECEPGNENSDNSLYSTTVNEGEVVSHYPRT
ILHSFLFPPLSSTPTANPDQIGPHLKSVAGGSSSSNKIPAGKMNTRDQVLLPPAHPSSDP
GHHRVPGITYPPNFPHVPTPDPTSPDRGLPGAVEVQQSSSTTGMVVGIVAAAALCILILL
YAMYKYRNRDEGSYQVDQSRNYISNSATQSNGALVKEKQPSTAKTVTKNKKNKDKEYYV
Download sequence
Identical sequences H3CZW0
99883.ENSTNIP00000013796 ENSTNIP00000013796 ENSTNIP00000000808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]