SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000902 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000902
Domain Number 1 Region: 1553-1776
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.05e-80
Family Fibrinogen C-terminal domain-like 0.00000249
Further Details:      
 
Domain Number 2 Region: 840-1010
Classification Level Classification E-value
Superfamily Fibronectin type III 3.28e-21
Family Fibronectin type III 0.00044
Further Details:      
 
Domain Number 3 Region: 1290-1379
Classification Level Classification E-value
Superfamily Fibronectin type III 1.44e-20
Family Fibronectin type III 0.0000909
Further Details:      
 
Domain Number 4 Region: 1382-1541
Classification Level Classification E-value
Superfamily Fibronectin type III 1.18e-19
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 5 Region: 571-748
Classification Level Classification E-value
Superfamily Fibronectin type III 2.09e-16
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 6 Region: 747-837
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000373
Family Fibronectin type III 0.0000732
Further Details:      
 
Domain Number 7 Region: 1023-1109
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000286
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 8 Region: 1205-1290
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000552
Family Fibronectin type III 0.002
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000902
Domain Number - Region: 327-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000221
Family EGF-type module 0.062
Further Details:      
 
Domain Number - Region: 483-507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000297
Family EGF-type module 0.059
Further Details:      
 
Domain Number - Region: 513-537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00198
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 420-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00312
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 390-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0035
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 545-568
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0064
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 358-383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0067
Family Integrin beta EGF-like domains 0.058
Further Details:      
 
Domain Number - Region: 265-289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0168
Family Integrin beta EGF-like domains 0.079
Further Details:      
 
Domain Number - Region: 235-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0175
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 451-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0175
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 204-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0221
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 297-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0259
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000902   Gene: ENSTNIG00000010597   Transcript: ENSTNIT00000003851
Sequence length 1783
Comment pep:novel chromosome:TETRAODON8:Un_random:23981397:23997800:1 gene:ENSTNIG00000010597 transcript:ENSTNIT00000003851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTKTILLVCLSVSLLFQLSAAGLVRKIIRHRRETLMPKKSQENLTLPHPDQPVVFNHVY
NINVPSTSLCSVDLDLPGEPEVKHKTPLRGVQNMEHIEHTEDGDNQIVFTHRITIPKQAC
SCENQLLDVKSILNRLEMLELELSSLREQCSGGAGCCGAQVAGEISTKPYCNGRGNWSSD
TCSCLCEVGWKGQNCSEPDCPGDCQDQGRCLNGRCECFEGFGGDDCSAELCLLDCGDYGH
CVSGVCLCEEGFSGQDCSQTNCLNSCLGRGRCLEDECVCDEPWTGLDCSELICPNDCYDR
GRCLNGTCECEQGYAGEDCGDLSCPGLCSNRGVCLNGQCVCQSGYSGDDCSKLTCPKNCN
EKGHCFNGKCICDPGREGEDCSVLSCPDNCNDRGQCVDGACVCDAGYQGEDCGALSCPNN
CLDRGNCVNGQCVCDKGYSGEDCSVKTCPKKCMERGDCVDGKCMCFPGFKGKDCGEMTCP
GDCSNQGRCESGKCVCHKGYTGEDCSLKTCPKNCHDRGYCIDGNCVCYEGFTGPDCSTLA
CPSDCQNQGHCKNGVCVCEEGFIGEDCSQVSPPKDLTVVEVTPETVDLSWDNEMRVSEYL
VKYVPTAPGGLELDMQVPGDQKKATILELEPGVEYLIRVYAVLNNKKSIPVDARVALDLP
KPDGLKFKSVRDTSVEVEWDPLDIPFDGWNLIFRNTKEEDGEILNSLGQPETTFEQSGLG
PGQEYEVKLEVVKNNKRGPPASKSVITMIDSPNQVDIRDVTDTTALLTWLPPVAEVEEVS
ISYGPSSNPADRNVVELPSTESQYHLGGLDPDTHYQVSLTAHKGDWSSKPVHESFLTELD
APKNLKTAEITDESITLEWENSRAQVDNYRIKYGPLSGGEHRELLFTPGAKDHTHAKITG
LRASTEYGMGVTAVKDERESLPTTTNAVTALDSPKDLTVTKVTETTMLLEWRHPQAKLDS
YRLVYVSADGHRREEVLPGDLKSYSLVDLSPGTLYTISISAERGSRTSAPNTVSAFTEEE
KPLVTSFTISDVSWDSLQLSWEAPDGAFQAFLVKVTDAETGSEVQNHSVVAGARSFAISD
LSATTWYRVSLYGLHRGALLGPVTADTITGSNVTAYPPLSFLFYSLNMQSQFSQYGLLSI
LLLPVGLGLGTAWPGGSRVVHNMAWAQLGPAVCMLMAAETSSTFFLSESLHPKKTQTIPE
AEPEIQALLVSAVTPGSFRLTWTAEEDALDTFVIMVSPADDPGHPTELVLASEQRSVAVT
NLTEDTQYKIQMFGLRFGRRTKSVQESVRTDLAPPKGIRFSDVTDTSTTVHWGAPRVRVD
SYQITYVPAHGGSAKTLTVDGSKSQTVLPNLTPGVTYEVTIVAVKGSRESLPASDSITTA
LDKPRGLVAVNITDTGALLLWQPAIATIDGYVITYSADAVDPVMERVSGNVMEFQMSSLV
PATRYTVKVFAARDLAKSAATSTEFTTDVDTPTHLAASSIQTESAMLTWKAPRASITGYI
LSFEAVDGTVREVVLSPTAVSYNMAQLSASTEYSVRLQAIAGPKRSRVVAAVFTTTGVQY
RHPRDCSQVLLNGDGASGPYTIFLGGDENQPLQVYCDMSTDGGGWIVFLRRQSGKLDFFR
NWKNYTSGFGDMNDEFWLGLSNLNKITAAAQYELRVDLRDKGETAFAQYDRFSVSEPRSR
YKVHVGGYSGTAGDSMTYHHGRPFSTYDHDNDIAVTNCALSYKGAFWYKNCHRVNLMGRY
GDNSHSKGVNWFHWKGHEHSIEFAEMKLRPSNFRNLEGRRKRS
Download sequence
Identical sequences H3BY37
99883.ENSTNIP00000000902 ENSTNIP00000000902 ENSTNIP00000000902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]