SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000001291 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000001291
Domain Number 1 Region: 394-567
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-49
Family SPRY domain 0.00069
Further Details:      
 
Domain Number 2 Region: 8-79
Classification Level Classification E-value
Superfamily RING/U-box 1.17e-18
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 140-203
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000397
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000001291   Gene: ENSTNIG00000001084   Transcript: ENSTNIT00000004168
Sequence length 572
Comment pep:novel chromosome:TETRAODON8:3:4011004:4015387:1 gene:ENSTNIG00000001084 transcript:ENSTNIT00000004168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTKLWTDEQFNCPVCLDLPNDPVTIPCGHSYCMGCIKDFWSKDEPKGIYSCPQCRQVFC
PMPSLSRNTMLAEAVEQLRKGALKADSTSKGKLSSSAVACDMCKGKQNAAVKSCLVCMSS
YCEAHLKPHQTKKALKQHELIPPTSNLAEKICTQHKYLQEFFCRQCQTFICWLCTSNQHK
GHESVSTKVERLEKQKVLSELQTETHQRLKDREQELKDLKKVMDVMKRSAGKVHSETERT
LTELQRSVERLQELMEEVLDQANLEKMSQAQEVADSLEAEIKVLRKRDTEMRDLAQCEDH
IHYLQTCESMSGPLETGALPTVAVNQEASFEPVLDAVLDLRERVEDMCNQELGKITKRGL
GNVGVKNLDVRSRDTPRVREINIDSFQAPEPRSREEFLQYAIALTLDPNTAHRRLAISEG
DTKATLQGAAQPYLDTPERFDGWTQVMCQGPMYAQRCYWEVEWRGRGSSIGVAYGAVSRK
GSDARSGLGYNARSWTLELSDTCCAAMHDNQKRDIPVTYSPRLGVYLDLSSGTLAFYSVA
DSMTHLHTFHANFTQPLYAAFGVGTGVGVGLD
Download sequence
Identical sequences H3BYK4
99883.ENSTNIP00000001070 ENSTNIP00000001070 ENSTNIP00000001291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]