SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002157 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002157
Domain Number 1 Region: 138-400
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.67e-57
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 460-586,629-801
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.7e-39
Family Patatin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002157   Gene: ENSTNIG00000018843   Transcript: ENSTNIT00000002350
Sequence length 814
Comment pep:novel chromosome:TETRAODON8:18:10127832:10133993:-1 gene:ENSTNIG00000018843 transcript:ENSTNIT00000002350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFLGRLLDTVSSNLFANPYRVRDVPLSDYAGGGKIKLREEGRMVLYKNNQCRSWDCLLM
CPEMPMSTLRLFQVASEEDAMNWFPHYALTLQPFYEMLPLKAETTQPIVDCIRSHPDWSS
AHVAIDTGLRECLKHNYVQSQINSRDAAGQTPLHLACERGDPVCVKELLEESQAQTDIKD
RSGQTPMHMAAKHDSPAVIQVMCSRMCSGVNELNNSGETPLHVACRLGRVESVKALLAGG
AKCDIIGGAGYPIHSAMKYSEKCCVEEVLKADSGQLHAEDSAYGGTPLHWAKTAEMCRVL
LEHGCEINYLSKTGESPLHIMTKKGRFEAAMVLLTHGANANLKGQDGNTALHLAMKLDHI
ELIKALIVFGADVEIHNDLGETPGLIAARTSKGPNRKILLDMLCSVGVQRCHPPSLNSSP
PNFKPAAIGFEDIIYMGAAVAAMSRGSSQVDGCKMQKNRMDRLLCLDGGGIKGLVLIQML
IALEKEAGRPTRELFDWVAGTSTGGILALAIIHGKSMEYLRCLYFRMKEQVFKGSRPYES
APLEEFLKKEFGENTKMTDIRYPRVMVTSVLADRHPGELHIFRNYDPPSVHREAPYATTA
TFKPLTIPQGWEDEDVLIVGYTEEPPRKRRKVADEEQLVWRAARSSGAPTYFRPMGRFLD
GGLLANNPTLDAMSEIHQYNKALKAEGREKETKKLGVVVSLGTGKPPQVAVSSVDVFRPS
NPLELAKSFVGAKELGKMLVDCCTDSDGCAVDRATAWCEMIDTVYYRLSPQLSQEVLLDE
VSDAALVDMMWETQMYLYEKRESLQSLAKLLLNN
Download sequence
Identical sequences H3DNC9
ENSTNIP00000022028 ENSTNIP00000002157 99883.ENSTNIP00000022028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]