SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002165 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002165
Domain Number 1 Region: 680-702,812-966
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.97e-25
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 261-324,453-528
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000582
Family Extended AAA-ATPase domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002165   Gene: ENSTNIG00000013999   Transcript: ENSTNIT00000002643
Sequence length 999
Comment pep:novel chromosome:TETRAODON8:Un_random:5206626:5211073:-1 gene:ENSTNIG00000013999 transcript:ENSTNIT00000002643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSVDEAADALMTRLGFLLGDKIIPGQPESSYPAQDDGENSKVFNSSFQRISPSSSLASSS
TSPCSTLPPPAGGEVNSIVRHAPSNHVSVTSPTSTLESRDSGIIATLTSYSAESAAERDD
VAKYRSDGYHGSRGQRGGQLVASSTSSSCMAAAGRDNDGFLYSVEDNMAASTYSLNKLHP
DRASSSSHSAGSTYSIPLYLMPRPNSVAATSSARLEDLAYLDEQQRHIPSRTSLRMPRQN
SGSRGQQEHRVSFTPSLNLKPLHFEIPGLSSDWLFSGREWLFQEVDAHLRSGDPASNHGV
VIVGNMGFGKTAIIAHLAALSCHGNRMWPTAAGNQTMPKRNFDPHEQIDETDMEAVSLSH
NSLGRGREDEGGGSCPGTPELRRRQEEVVRRLAAQVVSYHFCQADNCHTCLVPEFVLNMA
AMLSDAPQLLAYRERLHRSRELQSTLSMRACIQDPSSALEKGILEPLDALYRERKLHLDR
AGLIVLVDGLNEAEFHRPDYGDTLTSFLSKNIQKFPSWLKVIATVRTSQQDITGPLPFHC
ISLDRIDENSAIDQDLQGYLMQRIHSSAEIQSNVSLSNGRLDNTALAKLISHLKTLSKGS
YLYLKLTLDLIEGGYLVLKSSSFKVVPVSLAEVYLLQLNMRFPTQSSFQRVLPLLNITVA
SLHPLTDQKLYEIVNAGTLGRGALPWAEFTHRLEVSPFLLRRNDGSRMLKHASFREWLMW
REEGQDDRFLCDPRSGHTLMAFWLCRQEGKLNRQQVLDLGHHILKAHIYKGLSKKLGVSS
SVLQGLWLAYSTQSLSPALSSLRNLYTPNIKVSRLLIMGGADVDHRTDVLSNAPLLCAHA
HLGHADVVALLLDQGAQVGAQSHDGVSALGFAAAAGHLDIVTMLSQNAAKVGHVDNSGRC
VLVHAAQRGHIEVLCYLLRNADWSCTPCCSQKAASKDQAVQQALTAAASMGHAQVVSYLL
DLSGKDDKNGQSPEINTPDSLWGETGTVHANVSSQEGEA
Download sequence
Identical sequences H3D915
ENSTNIP00000017006 ENSTNIP00000002165 99883.ENSTNIP00000017006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]