SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002609 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002609
Domain Number 1 Region: 631-822
Classification Level Classification E-value
Superfamily Sec7 domain 1.19e-71
Family Sec7 domain 0.00000246
Further Details:      
 
Domain Number 2 Region: 357-564,1079-1474
Classification Level Classification E-value
Superfamily ARM repeat 1.95e-25
Family MIF4G domain-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002609   Gene: ENSTNIG00000004914   Transcript: ENSTNIT00000000713
Sequence length 1764
Comment pep:novel chromosome:TETRAODON8:Un_random:72944738:72963090:-1 gene:ENSTNIG00000004914 transcript:ENSTNIT00000000713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEENKTKSMFLSRALEKILSDKEVRRSQHDQLRKACQVALDEIKAEQDQLREANVVQPRA
SYVEADKYVLPFELACQSKSPRIVSTSLDCLQKLIAYGHITGNALDSRTPGRRLIDRLVL
PAVQALLTIVTSAHIEIHEGTVLLTVRTCYNIYLASRNLINQTTAKATLTQMLHVIFTRM
ESQAHSDCTPPPEPQSSPHHLVPSGEDNTSSTAMSTSPASASDGTQDSTTNATNTTSVNG
EQRRGGASPKGGSGGLLTPSSEPDSVFEDVVDEPAEEAVVDPEEGGHQLTQMDNGADDQP
PQLIGEKQEKPPSTAGAPQMNEMTEDRASISSTELLDADALQGPQNTARFSHILQKDAFL
VFRSLCKLSMKPLAEGPPDPKSHELRSKVVSLQLLLSLLQGAGPVFRAHEMFANAIKQYL
CVALSKNGVSSVPEVFELSLAIFLTLLSHFKIHLKMQIEVFFREIFLTILETSSSSFEHK
WMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRSGQELGMTPLQE
LSLRKKGLECLVSVLKCMVEWSKDMYVNPHLQTNLAGTGQENHPEVATEAGVLRLPELPP
GRRDSVSSLDSSVSSSLPASHTDLPEQYQVIKQQKDIIEHGIDLFNKKPKRGIQYLQDQG
MLGVTVEDIAQFLHQEERLDTTQVGEFLSENSKFNKEVMYCYVDRLDFCGRDFVSALRTF
LEGFRLPGEAQKIDRLMEKFAARFLECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVK
NKMTKEQYIKMNRGINDSKDLPEEYLSAIYDEIAGKKIAIKESKEFSITPKSSKQSVASE
KQRRLLYNMEMEQMAKTAKALMEAVSHAQAPFFSATHLEHVRPMFKLAWTPLLAAFSVGL
QDCDDPDVASLCLEGIRCAVRIACIFNMQLERDAYVQALARFTLLTASSSITEMKQKNID
TIKTLITVAHTDGNYLGNSWHEILRCISQLELAQLIGTGVKPRYISGVGREKELSIRGLP
SGAEEFMPLGLANVVGGQDRRQMAHIQESVGETSSQSVVVAVDRIFTGSTRLDGNAIVDF
VRWLCAVSMDELASAHQPRMFSLQKIVEISYYNMNRIRLQWSRIWQVIGDHFNKVGCNPN
EDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIVKKNRSPTIRDMVIRCVAQM
VNSQAANIRSGWKNIFSVFHQAASDHDESIVELAFQTTGHIVTNTFQEHFASAIDSFQDV
VKCLAEFVCNTAFPDTSMEAIRLIRHCARYVSQRPQTLREYTSDDMNVAPGDRVWVRGWF
PILFELSCIISRCKLDVRTRGLTVMFEIMKSYGHTFERHWWQDLFRIVFRIFDNMKLPEQ
QTEKTEWMTTTCNHALYAICDVFTQFYEALSEILLADIFTQLQWCVRQDNEQLARSGTNC
LENLVILNGEKFSSQVWDITCSCMLEIFRSTSPHALLTWRPAGQEEETADGKYLDADLDS
QSHSSYDKALSERGPSQLSSEDACRSKSKVSDQKLFAGLLIKCVVQLELIQTIDNIVFYP
ATSKKEDAENMAAAQRNALAGLEAEAHLGPDQGMYVHMSSAHLFKLLDCLLESHTFAKDF
NSNHEQRTALWRAGFKGKSKPNLLKQETSSLACTLRILFRMYSDPKLQDCWPDIQTRLLL
LGGEALDYFIGLTSESHREAWNSLLMLLLTKTLRLPKDKFRPHASCYYPHLCEMMQFDLI
PELRALLRSFFLRVGYIFHISVPD
Download sequence
Identical sequences H3CH50
ENSTNIP00000002609 99883.ENSTNIP00000007578 ENSTNIP00000007578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]