SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002646 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002646
Domain Number 1 Region: 109-212
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-33
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 2 Region: 275-374
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-29
Family Spermadhesin, CUB domain 0.0007
Further Details:      
 
Domain Number 3 Region: 47-107
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000195
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 220-286
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 5 Region: 2-48
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000089
Family Spermadhesin, CUB domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002646   Gene: ENSTNIG00000001199   Transcript: ENSTNIT00000004062
Sequence length 374
Comment pep:novel chromosome:TETRAODON8:8:3812704:3815892:1 gene:ENSTNIG00000001199 transcript:ENSTNIT00000004062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IICRLTGSFVPDLIVSMSHQMWLHLQSDESVGSIGFKINYKEIDKESCGDPGTPLYGFKE
GSGFLNGDVLRFECQVGFELIGEKMITCQNNNQWSANIPICIFPCFSNFTAPMGTVLSPD
YPEGYGNNLNCVWLIISESGTRIHLAFNDFDLEPPYDFLTIKDGDQSGAALLGRFSGAEV
PSHLTSNSNVLQLEFQADHSMSGRGFNITYSIQAFGRNECPDPGIPLNARRFGDSFQLGS
SISVVCEEGFIKTQGADTITCHLEEGKVMWSGLIPKCEAPCGGHYSGPSGVILSPGWPGY
YKDSLSCEWVIEAEPGSSIKISFDRFQTELSYDFLEIHDGPNLLSPMIGSFNGTQVPQFL
FSSSNFLYLLFTTD
Download sequence
Identical sequences H3C328
99883.ENSTNIP00000002646 ENSTNIP00000002646 ENSTNIP00000002646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]