SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003381 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003381
Domain Number 1 Region: 1067-1234
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.82e-37
Family Ankyrin repeat 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003381   Gene: ENSTNIG00000015638   Transcript: ENSTNIT00000001422
Sequence length 1264
Comment pep:novel chromosome:TETRAODON8:12:3978024:3984732:-1 gene:ENSTNIG00000015638 transcript:ENSTNIT00000001422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKDPYYVETPYGYQLDLDFLKYVNDIERGNTIKKLSIQRKPKVTKSLSVPRGSTGGGSTQ
AEWTSTDSLSSSNSDDKQSPVFFNPRSQSSSPATPTLPRQATSEVPLQQPYLSITEQKPL
LPPPSPRFALRHNPQVERTLMETRLRLEQERLLMQPHVDPPLPRRRLASFGGMGSSSSLS
SYSGSIVQSQISPSAHPAFTINGHPHNGEYNPYYPASMGSSIRHSPLSSGMATPVTNVSP
LHLQQIREQMVVALRRLKELEEQVKTIPILQVKIAVLQEEKRQMAAQSKNQGPGGFRKRS
YSVGSADQMENPGPFPKEPELHIREPEAQEHSSQCLEEFRRLAAQVQALEKTSQESNMDE
VHSQKLLQNQTHQKSVGIVTDENMNSLPVLHGKLTSGLCFQDAGVSTERPESSSVAVGVT
EAMLGVTSEAEKEIELQHQAIEALKDKIYRLEVQLKETTHEMEMGKLKLELQAAGGSNKK
KADKGFMVRPEMYSVFVEAKVQMRTQGVGNHLESSHANAAKSSQACTVGVSCQPSLESVA
SGPEIPMDRWVVHELVEVKDQCVGRRVETCDQLVGVEVNACEAGVNTEESMGSLALSKAK
FSKESRSVGCGDCSVDVTVGPIKVLGSRGTNTDLISKVDSSVTAAPESANQQTNTDLEVV
NKSTNTKTVVLTDCFTDMTFITCDKHTNTAVTETRTVAAGEGLVKDVTSATKMRSIAVGT
TASVDAFLGKSSCHTKNKECGVGAVSIHDNFLVGRNTRNIACGPSQPNGSLTSKETTEVK
ASPAPAQAQEGAGLDHYIERVQKLLQEQQMLLAENYSELADAFGQPQSQFGSINSQLVST
LSSINTVMRYGSSEDILKLQSDPASLKDFQELGLTFLFFLIESSENLSSQHAEMSSVQSS
AEPNRSSPAQLQMNATTQKSSMDLQMSTALHGQPSSQSTLKSIMKKKDGKPDSNGTKKNL
QFVGVNGGYETTSSDDSSSEDSSSTVSNSGFFQRYKPSEKMLAACSVLSAHLCDSKAVSS
KDLRACVNTVQHEWFRVSSQKTALATMVEDYLSAFRDVSPAVLNHIANMADGNGNTALHY
SVSHSNFHVVKKLLDADVCNVNQQNKAGYTPIMLATLAAVDTPKDMRTVEELFSKGDVNA
RASQAGQTGLMLAVSHGRMDMVQALLAHGANVNIQDDEGSTALMCASEHGHVEIVKLLLA
QPGCDATLSDSDESNALSIALEAGHKDIAVLLYAHVNFSKAQSPGTPRLGRKMSPSPTRR
GMFD
Download sequence
Identical sequences H3DDW9
99883.ENSTNIP00000018712 ENSTNIP00000003381 ENSTNIP00000018712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]