SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003396 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003396
Domain Number 1 Region: 167-338
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-36
Family Laminin G-like module 0.0025
Further Details:      
 
Domain Number 2 Region: 35-174
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.55e-33
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00086
Further Details:      
 
Domain Number 3 Region: 563-585,789-950
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.89e-28
Family Laminin G-like module 0.0058
Further Details:      
 
Domain Number 4 Region: 975-1171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.55e-26
Family Laminin G-like module 0.0057
Further Details:      
 
Domain Number 5 Region: 359-513
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.06e-24
Family Laminin G-like module 0.0046
Further Details:      
 
Domain Number 6 Region: 571-629
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000464
Family Fibrinogen C-terminal domain-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003396   Gene: ENSTNIG00000011693   Transcript: ENSTNIT00000000884
Sequence length 1270
Comment pep:novel chromosome:TETRAODON8:3:12862916:12871177:1 gene:ENSTNIG00000011693 transcript:ENSTNIT00000000884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCSAQSHSCCMSAHFRGRWGGGGEGECVDPLVSGLYASSFLASSRYNFLYSANFAKLYGS
SGWSPSPRDRQPWLQVDLGRKYRLRAIATQGTFNSYDWVTKYTLLYGDRPDAWTPYVMKG
GNQTLPGNWNYYQVKRNVFHYAFTAKHVRLIPLAWNTENGGKIGVRLELFGCSYDSYVLQ
YNGDDSVVYMYPGKRSRSLQDHIAINFKTLEQDGVLLHSEGIQGDLFTLELKRGRLYLHI
SLGSSVIHKVDGRMTLSAGSLLDNLHWHYVTIKRHGRQVNFTVDSQTVTGICNGEFTHLD
LDTQLYVGGVIEQNLPHLPSTPNFRGCLENVFINGVNIIDKARREDPEIRIPGKKKMHFA
CRDILLKPMTFAGPNNYLQVPGFFRRPRMFVKFKFRSWDYTGLLMFTRFADDLGALELGL
SEGQINVTIFQPGKKKLQFGAGYRLNDGYWHSVDLAARDNLLTLTIDEEEGSPLKITNPF
TIRTGDRYFFGAVRKCETKLNRFHGCMQHIFIDNEQLDIDIILQRQWGRYAELLLGTCGI
TDRCSPNPCEHEGRCIQSWDDFICLCENTGYKGEVCHMSVYKESCEAYRLSGKYWSGNYT
IDPDLSGPLKPFEVYCKMKSFKSWTVIMNDRVAGTTVSGSSIDQPYIGNVNYWNASWEVS
ALANTSMYCEQWIDYSCYKSRLLNTPNGRPFGYWIGRDNVSHYYWGGTFREVQMCGCAIN
QSCTDPKFQCNCDADYRQWYSDKGYLDFRDHLPVRKVVIGDTNRTGSEARFTVGPLRCHG
DRNIWNTIAFVKPTYITFPTFRPGSTADISFHFKTYRDHGVFLENSDDQLRNFIRIELNT
THNLAFIFMVGDGILNVTLKSPVPLNDHEWHFVQAEINVKLARIKVDYWAVRRFPGQTFV
TMKFTHPLLVGAANRTLRPFLGCLRGLRMNGVPLDLEGKVNEEQGIRRNCTGQCLNATIP
CRNSGQCIEGYASYTCDCNNTAFDGFYCHKDIGAYFELGSWLQYNIWKKPISDEALWANW
IDPHYDNFSLGYNDTADDIEFSFSTVYTPAVLLYISSFVQDYIAVILKKDGSVDLRYRLG
LITHKYQLTHRNLADGFPHYINITRHNRTIKTQVDYMEPVVEKITLVEDARFDSPKSMLL
GRVMEVGDIDYDIQKHNAPGFIGCISGVRYNIYAPLKAFFRPNETDPPIKTQGYISESVC
GAFPPVLGYVPWEVDPWFTGIEYFYIHDDLGLFWLTVIVILALLLLFGGLYSIYVYAYQQ
KGSYRTNEPK
Download sequence
Identical sequences H3D2A6
ENSTNIP00000003396 ENSTNIP00000014644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]