SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003416 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003416
Domain Number 1 Region: 477-737
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.39e-91
Family Eukaryotic proteases 0.0000211
Further Details:      
 
Domain Number 2 Region: 226-334
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-23
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 3 Region: 339-373
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000249
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 126-221
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000144
Family Spermadhesin, CUB domain 0.0087
Further Details:      
 
Domain Number 5 Region: 450-489
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000107
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 415-446
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000602
Family LDL receptor-like module 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000003416
Domain Number - Region: 375-409
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0903
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003416   Gene: ENSTNIG00000001040   Transcript: ENSTNIT00000001921
Sequence length 738
Comment pep:novel chromosome:TETRAODON8:6:3544346:3548054:1 gene:ENSTNIG00000001040 transcript:ENSTNIT00000001921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFAELYESSPWSSYHLHSGITAFSEGAEGLKAFYWSKFSAPEHVAAAVRRSRPERLQRRL
PCSNKVQRCGRDQHSYYMEPEERSDKSKNPNSLQAGKWQLGFQAMSFDLYAKYGNNRTLS
LVSPKKPYYQWRLRVPSGHVVQLVVLTLHGATPGSCSAHKLSAYDFLLPLQNKIIARWCG
LPVSGSSPVMKLTSSGNVMLVTFSFSRQRDGAIFKAYFQAIPKAACGGSISSWNGSVSSP
HYPSFYPPNVDCIWTVKAPLPGYLLSVTIVALDIQDSPSSDGCEKDWLDIGGVKLCNPAS
HSSKKRVHSSPLLVHFHSDESLTNKGFYLLFQAFSPEGACPRQFRCGDGRCIPLRRVCDG
VKDCPDGRDEAKCSSCRPGEVMCGGRCRPEAHPCARPGSCADSSEEGACGGKCSHACPNQ
PCLKRASVCDGVLDCRDRGDELNCTRAYLKGCSSSSYKCSNGKCVNKVNPECDGVKDCPD
GSDELRCRCGTRPRKRTKIVGGSDAGPGSWPWQVSLQMERYGHVCGATLVSSRWLVSAAH
CFQDSDLIKYSDARAWRAYMGMRVMTSGSGGATIRPIRRILLHPKYDQFTSDSDIALLEL
SSPVAFTDLVQPVCVPSPSHTFKTGTSCHVTGWGVLMEDGELASRLQEASVKIISRNICN
KLYDDAVTPRMLCAGNLQGGVDACQGDSGGPLVCLERGRRWFLAGIVSWGEGCARLNRPG
VYTQVVKFTDWIHQQTKG
Download sequence
Identical sequences H3C6V3
99883.ENSTNIP00000003974 ENSTNIP00000003974 ENSTNIP00000003416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]