SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003444 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003444
Domain Number 1 Region: 3-91,149-263,301-422,517-578
Classification Level Classification E-value
Superfamily MFS general substrate transporter 4.97e-29
Family Glycerol-3-phosphate transporter 0.085
Further Details:      
 
Domain Number 2 Region: 438-488
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000795
Family Ovomucoid domain III-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003444   Gene: ENSTNIG00000006366   Transcript: ENSTNIT00000000792
Sequence length 671
Comment pep:novel chromosome:TETRAODON8:10:10366405:10373257:-1 gene:ENSTNIG00000006366 transcript:ENSTNIT00000000792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMFLVALSFAYFAKALCGSYMKSTITQLERRFDIPSYLIGVIDGSFEIGNLLVIAFVSYF
GAKLHRPKIIAVGCVLMSIGTFIIALPHFITGRYEFETSVRWVENSTQNLAPCPVGSPAD
FTKGKEQIYHCAVFLGCEGESNLSMWIYVLLGNVLRGIGETPVQPLGISYIDDFATEENA
ALYVGCVQTISVVGPVFGYLLGSLCAKIYVDVGFVSMDSITITPADARWVGAWWLGYLIA
GVITLLSAIPFWFLPRSLLKGPEKSTPEQKRKETPLLKHKYPAEDSSFLEMAQGSVPNQA
LYLSSEFFPTLRTLLSHRVYLIYLCVTIIQLNSLIGMVTYKPKYIEQHFRQSASKANFLM
GVINIPAVALGIFSGGLLMKKMKLNIMEAAKFAFGTSLIGYLLSLIFFAMSCENAKVAGV
TVSYNSVDTISYDRHSEFTGCNSDCFCSANDWDPICGENGITYVSPCLAGCTSSAGSGKN
TVFSNCSCIGVAGNFTASTGQCHHTDDCDSMFPYFLALSVITSFIISLGGTPGYMILIRC
IKPQLKSLALGFHALATRTLDTAGIPAPIYFGAIIDTTCLKWGQKRCGGLGACRIYNTTA
YRVAYLGLTLSLRTVSFIICIPGFVLLSRQLKKEERNGIHGALANGGAELEALRKEDFVI
SNLNQSQQSSD
Download sequence
Identical sequences H3C5C5
ENSTNIP00000003444 ENSTNIP00000003444 99883.ENSTNIP00000003444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]