SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003719 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003719
Domain Number 1 Region: 152-240
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 2.35e-21
Family Thyroglobulin type-1 domain 0.00015
Further Details:      
 
Domain Number 2 Region: 31-109
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.85e-19
Family Growth factor receptor domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003719   Gene: ENSTNIG00000000894   Transcript: ENSTNIT00000003860
Sequence length 244
Comment pep:novel chromosome:TETRAODON8:15_random:151138:152916:-1 gene:ENSTNIG00000000894 transcript:ENSTNIT00000003860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLYEKVVAVAAVVSVAVVRSSPVVGPEPIRCAPCTQETLNGCPAIPADCKQVLKEPGC
GCCMACALEKGASCGVHTAHCGEGLRCTPRPDEARPLHALTRGRGVCTEDPGQETEGVTD
HGSVHYLLSLNLPVDHQDTAEGQESIKAKLNAIRNKLVRQGPCHTELHAALDTITSSQQE
LGEKFTTFYLPNCDKHGYYKAKQCESSLVGPPARCWCVSSWNGKRIPGSDDLLGDSDCNQ
EIAQ
Download sequence
Identical sequences H3C649
ENSTNIP00000003719 ENSTNIP00000003719 99883.ENSTNIP00000003719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]