SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003785 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003785
Domain Number 1 Region: 349-506
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-28
Family SPRY domain 0.0014
Further Details:      
 
Domain Number 2 Region: 5-77
Classification Level Classification E-value
Superfamily RING/U-box 1.63e-16
Family RING finger domain, C3HC4 0.0099
Further Details:      
 
Domain Number 3 Region: 132-172
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000029
Family B-box zinc-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003785   Gene: ENSTNIG00000000413   Transcript: ENSTNIT00000002136
Sequence length 506
Comment pep:novel chromosome:TETRAODON8:15:2302018:2304633:-1 gene:ENSTNIG00000000413 transcript:ENSTNIT00000002136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLQRKLEDTLTCSVCQEIFKDPWQLPCGHSFCLSCLENLGEHSNTIPSRCPNCRKDFRPL
DRISKSFTLTNIAEEYQEFRRKENGPDRNVYCDCCPGNENQAVKTCVRCEVSLCSEHIRH
HLERPAFADHRLVEPLMEIKKRKCAVHAEVTRHYCRESRSYVCNLCTMESKWEKKTQAVM
FIIKTQLLRQEHLRQVDLRFEMLKHQVRESSQSIRSLQEDIQSQVCSWLRASDPLSLHVL
HILVGFPLGVIEPLTPLPPPPAYNCSVENQALTEAQKDQQTRIHHIYAVIAKHLVDDPLS
RHLPPVIKDEGKLSCEQFVDQKYLSLLNQILQLMKWKKKDKIHLSTGALMLDLETANEYI
EISNDLRTAKKVRTRMGYPRVPTRFHDAPQVLSAHCVRTGAHVWEVEAEGYWDVAVSFRR
TEDESRSRSTFGNNPHSWSLTHDGRGKLVAYHDGRKSAVSAALGSNRLAVMVDIEKGNIT
FASLGSTVERLHEFRAKLTQPVCLGF
Download sequence
Identical sequences H3C6B5
ENSTNIP00000003785 ENSTNIP00000003785 99883.ENSTNIP00000003785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]