SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004054 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004054
Domain Number 1 Region: 1-270
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.41e-60
Family FCH domain 0.0000000821
Further Details:      
 
Domain Number 2 Region: 521-592
Classification Level Classification E-value
Superfamily SH3-domain 5.38e-16
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004054   Gene: ENSTNIG00000012324   Transcript: ENSTNIT00000002596
Sequence length 602
Comment pep:novel chromosome:TETRAODON8:1:22683793:22690887:1 gene:ENSTNIG00000012324 transcript:ENSTNIT00000002596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GIDFLERYAKFVKERLEIEQNYAKQLRSLVKKYCPKRSKDEEPRFTSCLSFYSILNELND
YAGQRELVAEEMAHRVYGELMKYSQDLKAERKHHLQEGRKAQQYLDQCWKQMDNSTKKFE
RECRRGREVPLRSLFERLDNEHSTSSPNADVEKDAKNQFYARTHAADESKNEYASQLQNF
NAEQWKHFNNAIPHIFKNLQAMDERRTVKLGETYQSFAEAERRVIPIVSKCLEGMTAAAK
AVDERRDSAIVVESFKSGFEPPGDYPFEDFSQNLSRTGSDGTISNTPKGEREKDGGTGPR
PDPKHNMSRPKNKLWLFGKKPKSPSSAPPPPPPSSSSVFLSSRFSSDKVSHYLSEIKTTV
PRIPHNLRALRRGWSVKTAPSLEDFSHLPPEQRRKRLQQRIDELHKELQKEMDQRDALNK
MKDVYEKNPQMGDPSSLQPKISETICNMEKLRSEIHKNETWLTEVEGKQSSRDRRHSADN
HQRPPQGRESPEGSYTDDTSQEQHTPRHHARPPQPHRNSDPHEFDDEFDDDDPLPVIGHC
KALYGFDGENEGTLSMAEDEVLYIIEEDKGDGWTRARKQTGEEGYVPTSYVDITLEKSSK
GA
Download sequence
Identical sequences H3D454
ENSTNIP00000015292 ENSTNIP00000004054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]