SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004637 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004637
Domain Number 1 Region: 51-208
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.76e-27
Family Ankyrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004637   Gene: ENSTNIG00000002189   Transcript: ENSTNIT00000004780
Sequence length 458
Comment pep:novel chromosome:TETRAODON8:Un_random:19988855:19992739:1 gene:ENSTNIG00000002189 transcript:ENSTNIT00000004780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDEDDIYQEFEELDFEVLADEVDTRSISSDDSFYPPDNTSLLSGADSPEPISFFKACCNN
NAIIVKIMIRQGVTEEEVRETDRNRRTGLIVACYHGYVDVVMALSQCPYLDVNWQDNEGN
TALITAAQAGHMLISSYLLSYFPGLDLERRNCHGFTALMKAAVQGRAGCVRALMLAGGNI
QARDHGRSLTPREWALFTGRQETAALMQQLMARPCAEQFCDSFSLEWPMLEELVSQAQEP
RTCWRRMLGLCACCPYTFYMSNKVKPVDDGVLDHMVRVTTSICGPLVATACRTVCPSSPP
CLGKRRPAVQEILRRQRLAELKQGGPERLSNYKRFFQNSRVLLIPKTQERRASLQPQLLR
SMVAVSSVAARRASLLPLSMLRRSSVRPGLVVPRVRLCKAPTPTYVPEKVRRSPNKNQLQ
VPKWNYKMKRVERAQEEERRRLMPLMKRRTCPGLSRRT
Download sequence
Identical sequences H3C8R5
99883.ENSTNIP00000004637 ENSTNIP00000004637 ENSTNIP00000004637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]