SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004676 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004676
Domain Number 1 Region: 13-196
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.83e-22
Family Laminin G-like module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004676
Domain Number - Region: 196-218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0493
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004676   Gene: ENSTNIG00000002219   Transcript: ENSTNIT00000004819
Sequence length 226
Comment pep:novel chromosome:TETRAODON8:Un_random:49235665:49236774:-1 gene:ENSTNIG00000002219 transcript:ENSTNIT00000004819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPTRLCLCAGHSSLSFSGYYIRYRLYDLLPSEMKVSFRIRTLQSRGVIMFTPTQPCMLLQ
QWAEGKLWFRLACDLGGGPPGAMSISGSGVSDGRWHTLVLELNRNFSSLTLDNRYGDGSR
GPAFTHSLAAGTSVYFGALVQSPKSGLLDGQKDPEVLEGFQGCLDSVTINTNELPLHNKR
SQHAEVVGLAEVKLGCVLYPDVCLQQPCQNGAACSSRPSGGESPGV
Download sequence
Identical sequences H3C8V4
ENSTNIP00000004676 ENSTNIP00000004676 99883.ENSTNIP00000004676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]