SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005160 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005160
Domain Number 1 Region: 198-278
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.77e-26
Family PHD domain 0.0005
Further Details:      
 
Domain Number 2 Region: 395-686
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 0.0000000000000209
Family Hect, E3 ligase catalytic domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000005160
Domain Number - Region: 130-185
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00834
Family PHD domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005160   Gene: ENSTNIG00000002608   Transcript: ENSTNIT00000005306
Sequence length 696
Comment pep:novel chromosome:TETRAODON8:Un_random:53425477:53429072:1 gene:ENSTNIG00000002608 transcript:ENSTNIT00000005306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CALCLLGDDDPAVFGEKVVLRDHGFSIHYFCLLMSCGVYQRGEEDEGVFGFLVDDIKREI
RRSARLTCCLCKMKGASVGCNVKSCRKTVHFPCSRKMGFISQFTGLFPSYCPDHCPAQTL
CVSSELSLPQSCSICLDAIQPVLGHALLKCPCCHSSWFHRDCVQHQAHSAGLFFFRCTLC
NNKERFQAEMLRMGIFIPERDASWELEADAYSDLLEVYRRCDAEECLCSHGRAHSAKTGW
FEVIRCRLCGSRGTHRRCSRLRAGTRAWACTDCTQATDGKGLPHPAASSSAELSFVSPPG
HTSSGQPEEKPAGQVSAERPSTHQLQETSEDILRALARQLRPLGVQLEVGGAQALAAGLE
LVRRSDFDPAHTLNVSFKDVRQTSFPSSHLGGEAARQHFLELLMQQIQDSEVFEGPDGCR
NLALDSRALRDDLYYDVGCLLALCLVHRGPPVSFFSPALYQCLFNYPANQPLAVGHMTPS
TYFTCHVNKVAEAESVEELKAAAGACGAYLELAGCSAVSSLQEKEALVEDLVTFALITRM
QLPLQRFREGLRTLGVFDQVQLSPATFFSVFCRVSAQLTAPTLSRFFTVNFSEDQERLAK
EMSIVSFWRHLLLECEAGRSSVSLQDLLHFATGAREPPASGFLPPPSISFLHPAASSQRE
LGSKHLLLPVTSSYQAFKGSMEQAVSRHVHLLPSEK
Download sequence
Identical sequences H3CA88
ENSTNIP00000005160 99883.ENSTNIP00000005160 ENSTNIP00000005160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]