SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005248 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005248
Domain Number 1 Region: 578-902
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.13e-51
Family Diacylglycerol kinase-like 0.018
Further Details:      
 
Domain Number 2 Region: 56-109
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000478
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0069
Further Details:      
 
Domain Number 3 Region: 153-239
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000153
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0022
Further Details:      
 
Domain Number 4 Region: 387-449
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000586
Family Ras-binding domain, RBD 0.023
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000005248
Domain Number - Region: 301-358
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0119
Family Ras-binding domain, RBD 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005248   Gene: ENSTNIG00000002692   Transcript: ENSTNIT00000005394
Sequence length 937
Comment pep:novel chromosome:TETRAODON8:Un_random:53868308:53875868:1 gene:ENSTNIG00000002692 transcript:ENSTNIT00000005394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLELQEPGGARPSGLAMAESGRNTAALDASSRRTASPAAARGRAPASAARAGSRSSALGH
RLRRVTLSRPTFCHGCSDFIWGLVGYQCEVCNFMCHEKCVKVLQSVCSCLAPSAVQVPVA
HCFVPAGHRRRFCCVCRRQTEGDACAALRRQVCELHVHADCAIFSCADCRRTHQDATALE
DTFPHHWREGNLCAAARCEVCRRCCGSADVPTGMRCEWCGITTHGACYTSLPAECALGRL
RRMLLHPACVCLSSRNFSKMHVYRITESCSPDWATGSGSRGGPGPRDWSQLAPSPVTGKQ
FLRVFDGDDAVKRGSFRLVSVLRATKNEEVVEAALRAFYLPDQAQDYELHQIGGSQRLHS
DEVLDRSGWPKDGGEAWLLRARPRDADVIKVYAGWARAAEAFVPVPVSKASTSASVLAEV
LRQLQEQDKDASGCSLVEVLMSSRQVLKHTLSPQDQILDRLRDIRKVSLRQMNQTRFYAV
EKAAPRVCVHLLVGGLPPLLDRERYAQLLQEHLAVKSHLVTVSQVYSSQAGVSALQISCF
SEAERIYMLAKDTMVHNKTLTSLVVPEIQVQHLAVDACPLLVFVNPKSGGLKGRELLHSF
RKLLNPHQVLDLTNGGPLAGGGRLHMFRQVPRFRVLVCGGDGTVGWVLGLLEAVRHKLVC
REPPVAIVPLGTGNDLARILRWGSGYGGEDPHHVLVSVDEAEEVLMDRWTILLDAQDVSE
DGRNKEFLEPPKVVQMSNYFGLGIDAELSLDFHLAREDEPDKFTSRFHNKGVYVKVGLQK
MSQSRSLHKELLLQVDQRDVPLPSIEGLIFLNIPSWGSGADLWGSEVDGHFRKPRMDDGL
LEVVGVTGVVHMGQGQVQSGMRSGIRIAQGNYVRLTLSKAVPVQVDGEPWVQPPGHVIIS
AAGPKVRMLRKSKQKKKSSAGVKDGRSESPSSRDGGR
Download sequence
Identical sequences H3CAH6
99883.ENSTNIP00000005248 ENSTNIP00000005248 ENSTNIP00000005248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]