SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005633 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005633
Domain Number 1 Region: 920-1043
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-25
Family Ankyrin repeat 0.000000664
Further Details:      
 
Domain Number 2 Region: 1-80
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.89e-19
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 3 Region: 845-867,1050-1110
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-17
Family SH3-domain 0.00017
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000005633
Domain Number - Region: 164-243
Classification Level Classification E-value
Superfamily TM1646-like 0.0915
Family TM1646-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005633   Gene: ENSTNIG00000003062   Transcript: ENSTNIT00000005781
Sequence length 1119
Comment pep:novel chromosome:TETRAODON8:10:1246866:1268783:-1 gene:ENSTNIG00000003062 transcript:ENSTNIT00000005781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VILTVYLSDTQQMLTEVPVTPATRVIDVVEYCKEAGEGECHLAEVWSGHERVLPPELLLL
DLLQQWGPRRPEVSFYLRHCPAWTRGSLPIETCHFLNANGGAVKVEGEREREETKLNLPR
VELTLSELQEMASRQQQQIEAQQQMLIAKEQRLRYLHQGGRSNQAQSQSEAEKLQRLKER
VETQEARLKKIRAMRGQVDYSKLINGNLSAEIEHVSSLFQEKQAELQSAVLRVDQLTQQL
EDLKRGRLQLHSVSGPAALELRKLYQELQARNRLNLEQSNKLAQNKELLNKRNAQVTVMD
QRIEDLRERLHKKRAELSRMNGGGPSSPQTSGVSGRVAAVCPYIQVPAEGRKDAGYPLLA
DPPQKHTPLSHTRSLSVQPAVLAKVTLATVITAMPGLIDQGGFSIGSDVKQTRKNRLKVF
QISFSSKGEAKRGNEAAIKHPCDLSDTDDTDNAPLADHFGAARRSFRRRNVFLNIQEVFL
NVPLVMVPTPAPRTRQGGITAQPAPCLALPPVRWAGPAPVLQIPPSSLQRLQQRVSISSN
SNQGPAPSSQPSASSPQAERTDPPPAVAVRPYIPDHPSRPQSPRKGPASMNSSSIYSMYL
QQPQAKSYGSLSNRTTVKAGQSFSAVYGKPILPSSSASPSPVPFLQGGGGGGVKTCEQDA
SDGGKGGESGDGAILPPPNVDNIPRPLSPTKLTPVAHSQMRYQSDADLDVLRRRLSNAPR
PLKKRSSITEPEGPQGPNIQKLLYQRFNTLAGSMEGCSANTFYQPECILGEADNVGNVDP
GDKLAEGRSLNAGPLRSSPPSVVVETPKATTAKAEPAGDAPLQPSSSPAAERPEEQNSDN
QRRSSPSHTSVGHGSPSPSPPTHPPLTKVSLRLPLNSVRSLSFKTSSSPPVLQVKRTNLK
KPASERTGHGLRVKFNPLALLLDASLEGEFDLVQRIIYEVENPSMPNDEGITPLHNAVCA
GHHHIVKFLLDFGVNVNAADSDGWTPLHCAASCNSVHLCKMLVESGAAVFATTISDVETA
ADKCEEMEEGYAQCSQFLYGVQEKLGVMNKGSVFALWDYAAQHPDELSFGEGDALAVLRR
SDDAETEWWWARLDDREGYVPRNLLGLYPRIKPRQRSLA
Download sequence
Identical sequences H3CBL1
ENSTNIP00000005633 99883.ENSTNIP00000005633 ENSTNIP00000005633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]