SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006081 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006081
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 7.06e-44
Family P-domain of calnexin/calreticulin 0.000001
Further Details:      
 
Domain Number 2 Region: 110-154
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000791
Family Calnexin/calreticulin 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006081   Gene: ENSTNIG00000003493   Transcript: ENSTNIT00000006229
Sequence length 173
Comment pep:novel chromosome:TETRAODON8:Un_random:59480826:59481647:-1 gene:ENSTNIG00000003493 transcript:ENSTNIT00000006229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DRDEDAPAQVPDEAAVKPDGWLDDEPEYVGDPSAVRPEDWDEDMDGEWEAPQIPNPACET
APGCGAWKRPMVDNPSYRGKWKPPMVDNPNYQGIWKPRKIPNPAYFEDLQPFRMTPFSAV
GLELWSMTSDIFFDNFLVTDDRNTADRWAGDGWGLKRSAESAAEVTLKNTFLS
Download sequence
Identical sequences H3CCV8
ENSTNIP00000006081 ENSTNIP00000006081 99883.ENSTNIP00000006081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]