SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006336 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006336
Domain Number 1 Region: 479-539
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000000785
Family BSTI 0.051
Further Details:      
 
Domain Number 2 Region: 883-943
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000144
Family ATI-like 0.033
Further Details:      
 
Domain Number 3 Region: 998-1037
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000006336
Domain Number - Region: 85-114
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00556
Family ATI-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006336   Gene: ENSTNIG00000003736   Transcript: ENSTNIT00000006485
Sequence length 1085
Comment pep:novel chromosome:TETRAODON8:Un_random:61355398:61363504:1 gene:ENSTNIG00000003736 transcript:ENSTNIT00000006485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLQSVSKTQKTTSECEFGCCICACTPGIFKPCHAIVSPEQYFGNCVYDMCATDGQVGAL
CQAIESYADMCAAKGVVIKWRTDTFCPMKCPPGSQYNPCATACRQPTCQDPAGPAILAWK
DVSATLALSSVGTNVCRSASADATTRTESYRPVGDTWFTSKNCSERCKCNGNHNVTCEPW
QCSPAQECKVVDGLLDCHSTGKGVCHVAGDPHYYTFDGIMHTFMGTCTYTLVEVCDTAMV
TPFKIVAKNEERGQPQASYVRYVRIYLPGDTVVEMQKGRRVLVNGKRVRTPIEIEKAGAK
VIISGTYSLLDTSFGLQVKFDGVHHLEITVPGKYFNKLCGMCGNYNNQSSDDNLKPNKQP
AKDVIELGNSWKSDGDSDPGIHQNICPSSCQPDTRPDIHPNCTAEEEKVYESQCAQVIMS
DRFKPCHAVVSPDAFLGNCVYDMCEYDGMQSTLCDNIEAYAQACKSAGITISWRNSTFCP
IPCPPNSHYSECTPPCPATCSDLFPIFCHLPPTTCVEGCQCDAGHVLSDNKCVPLNECGC
LDSDREYHDVGDTWLTDKCGQSCTCNIGGKITCKDHTCGSNSVCELDKYGDYICKPSKFD
KCSISGDPHYRTFDQFTHHFQGPYTYILTQGHNLQSNMPALLVRGKNIRRGGNRRVSFLD
QVYIDVYGVSVRFLPKKTVLVNGERVSPPLSPVNGLKISMNSKEVQLTTTFGLTVKYDGN
NRGEIILPSTYRNYVRGLCGNYDGITRNEYMKPDGTVVRDLNTFGDSWRITDRQSSGLRS
NQVPHTVETDPDSGFQTSGCSQSQLNDYNGIAQCGALSDASGPFAACHKELPPQTYQEAF
NKSNQLDPRGQIEELRCASYEAYATACQNEGIKLGPWRQQLSCALTCSGNSTYSPCMTSC
PASCSNLAAPSECDTDNCIEGCQCAAGFVMSEEACVPYKECGCTFLDRYYTLKEKFVTED
CSESCECTTTGIVCQPKTCQENYVCTVYNLKRDFYKASPCLSYPCQNGGTCKEEGNNYKC
ECAFGFDGKNCEVVLDEDEDGGGVDYLNCGAGSGDSHRHCDRRCVCLQTQSKVSLKSLLL
AQKAL
Download sequence
Identical sequences H3CDL3
99883.ENSTNIP00000006336 ENSTNIP00000006336 ENSTNIP00000006336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]