SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006346 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006346
Domain Number 1 Region: 46-145
Classification Level Classification E-value
Superfamily E set domains 9.34e-17
Family Other IPT/TIG domains 0.0078
Further Details:      
 
Domain Number 2 Region: 248-336
Classification Level Classification E-value
Superfamily E set domains 0.00000000000644
Family E-set domains of sugar-utilizing enzymes 0.039
Further Details:      
 
Domain Number 3 Region: 143-193
Classification Level Classification E-value
Superfamily E set domains 0.000000028
Family E-set domains of sugar-utilizing enzymes 0.093
Further Details:      
 
Domain Number 4 Region: 1-32
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000733
Family Plexin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006346   Gene: ENSTNIG00000003746   Transcript: ENSTNIT00000006495
Sequence length 359
Comment pep:novel chromosome:TETRAODON8:Un_random:61664943:61679692:1 gene:ENSTNIG00000003746 transcript:ENSTNIT00000006495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCGMCLKANPRFECGWCVQNKKCSLKQECISGNGGWMHASSENSRCSHPRITKLFPETGP
RQGGTRVTILGENLGLQFRDIQMGVRVGKIPCMPVEEEYVSAERIVCLLNDATNYRVQEA
HVEVCVKDCINDYRALSPRPFTFVTPYFNRIQPSQGPISGGTRITVEGSYLNAGSYVSVR
FAQRPCFFKRKVKHCLLSCASFVGMNEGYAPNTVSNYLIDSGQKHYTFRLQFLRHKVTTK
LSLTFCIYSGGTLLTVSGTNLATIQEPKIRAKYGQVESFHNCTVYNNSVMVCLAPSVADS
ELGFSESGTDPDEIGFYLDNVNALVVVNKTFSYYPDPVFEPLSPSGVLELKPTSPLILK
Download sequence
Identical sequences H3CDM3
99883.ENSTNIP00000006346 ENSTNIP00000006346 ENSTNIP00000006346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]