SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006547 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006547
Domain Number 1 Region: 289-490
Classification Level Classification E-value
Superfamily vWA-like 3.03e-20
Family Integrin A (or I) domain 0.018
Further Details:      
 
Domain Number 2 Region: 142-259
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.74e-20
Family Synaptotagmin-like (S variant) 0.031
Further Details:      
 
Domain Number 3 Region: 10-130
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.43e-19
Family Synaptotagmin-like (S variant) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006547   Gene: ENSTNIG00000003939   Transcript: ENSTNIT00000006698
Sequence length 539
Comment pep:novel chromosome:TETRAODON8:Un_random:17135694:17139974:-1 gene:ENSTNIG00000003939 transcript:ENSTNIT00000006698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMADCVSKVELTVSCSNLLDKDVGSKSDPLCVLLQSSGADKWMELGRTERLKNTSDPSFS
QRLRLDYHFETVQNLKLGVYDIDNSTSDLGDDDYLGGVELTLGQIVSSKTVTRPLQLKKG
KPAGKGSITVTAEEIKDNRAIVLELEAKKLDKKDTFGKSDPFLEISKKGDDGKWQLVHRT
EVVVKNNLSPTWKKFTVPLQTFCCSDLERPLKVDCHDYDGDGSHDLIGSFTTKVSELQKA
AHGSPVEFDCIHPEKQKKKKSYKNSGVVSVKSCELVTQYSFLDYVMGGCQINFTVGIDFT
GSNGDPRSPNSLHYMSPDGLNQYLSALWSVGQVIQDYDTDKLFPAFGFGAKLPRDYQAAH
HEFALNFNPANPYCQGIQGIVEAYRMVLPQLKFSGPTNFSPIINHVASIASSSAQSNAAS
QYFVLLILTDGEITDLDQTRDAVVRASRLPLSIIIVGVGPADFKAMELLDGDDGVLRSTV
GEAVARDIVQFVPFRKFKDASKEALAQSVLAEVPNQLVSYFKMRGLEPAKAPPAPKPGA
Download sequence
Identical sequences H3CE73
ENSTNIP00000006547 99883.ENSTNIP00000006547 ENSTNIP00000006547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]