SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006573 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006573
Domain Number 1 Region: 99-215
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.45e-42
Family Pyk2-associated protein beta ARF-GAP domain 0.00014
Further Details:      
 
Domain Number 2 Region: 353-473
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-25
Family Ankyrin repeat 0.00049
Further Details:      
 
Domain Number 3 Region: 7-58,106-129
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000257
Family Pleckstrin-homology domain (PH domain) 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006573   Gene: ENSTNIG00000003965   Transcript: ENSTNIT00000006724
Sequence length 506
Comment pep:novel chromosome:TETRAODON8:Un_random:30803022:30805657:1 gene:ENSTNIG00000003965 transcript:ENSTNIT00000006724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDALTVVVEDLRLCSVKPFEDIERRFCFEVLSPSKSCMLQAESEKQRQAWIQAVQASIAS
AYRESPDTSEEKRLDRAASPSTSSIDSASEARERGARGDAILQRIQALPGNQQCCDCGQA
DPRWASINLGVLLCIECSGIHRSLGVHCSKVRSTLDSWEPELLKLMCELGNAVVNRIYEC
SSQDGGSRKPLPSSSRQEKEAWIRAKYVEKRFLKKACSAHAGQRKPERRRQECRRHSSSN
SLAKTRRRYRQEVGSASPSTLSAEAAKFRRESLFCPDELDSLFSYFDTGSGPRSLSSDSG
LGGSTDGSTDFLLFGSVAEEREVSEGSSGEAELERSLYASDTEEGRDLQPGALLHRASRN
QNLAAMAEALAHGADVNSADHADGGKTPLIQAVVGGSLIACEFLLQNAADVNQRDGRGRS
PLHHATYLGHTGQVCLFLKRGAAQGDADQDGQDPLSVAVQQANADIVTLLRLARMNEEMK
ESEGQAAPCACSPTEQQLRKCFQEFI
Download sequence
Identical sequences H3CE99
ENSTNIP00000006573 99883.ENSTNIP00000006573 ENSTNIP00000006573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]