SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006829 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006829
Domain Number 1 Region: 18-234
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.07e-84
Family Fibrinogen C-terminal domain-like 0.00000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006829   Gene: ENSTNIG00000004205   Transcript: ENSTNIT00000006980
Sequence length 235
Comment pep:novel chromosome:TETRAODON8:2:2752962:2755579:-1 gene:ENSTNIG00000004205 transcript:ENSTNIT00000006980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKESLVLLLLAVPILDSGHVVSMPADCSEIHNSPSGEYTICPAGDRSAVMVKCDMDTDQG
GWTVIGARTDGTVNFYRPWNQYKLGFGSPLSEHWIGLDNLHYMTSNKKYKLRVVLEDFDG
NTVFANYGSFSVGDECSGFQLTVGGFTDGGAGDALSHHNQMKFTTLDRDNDLYEKNCAKE
FLGAFWYHKCHHANPNGVYRWGLDGTLFAVGVSWYPWKGHEYSLKKYIMMIRPVQ
Download sequence
Identical sequences Q4T526
ENSTNIP00000006829 99883.ENSTNIP00000006829 ENSTNIP00000006829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]