SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007328 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007328
Domain Number 1 Region: 279-398
Classification Level Classification E-value
Superfamily EF-hand 2.47e-30
Family Osteonectin 0.0095
Further Details:      
 
Domain Number 2 Region: 191-260
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 5.1e-20
Family Thyroglobulin type-1 domain 0.0017
Further Details:      
 
Domain Number 3 Region: 54-130
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 5.76e-20
Family Thyroglobulin type-1 domain 0.0014
Further Details:      
 
Domain Number 4 Region: 11-56
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000152
Family Ovomucoid domain III-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007328   Gene: ENSTNIG00000004675   Transcript: ENSTNIT00000007486
Sequence length 419
Comment pep:novel chromosome:TETRAODON8:10:12023908:12034958:1 gene:ENSTNIG00000004675 transcript:ENSTNIT00000007486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QWLIGDRDSHCGVVCARTQVKAVCGSDGRIYESICELQRARCKDKTLVQAARGRCRDAGG
QSKCHADRSQALEHTRRPQESTFVPECNEDGTFAQVQCHTLTGYCWCVTSDGKPVSGSSV
RNRTPVCSGSVTEKPAGPSNPGRKDDGSKPTPTMETQVLGEGDEITGPTLLDIPEYKDNN
SSTSRKQEKVPSCDQERQSALDDARLHSRQAVFIPDCGPGGLYKAVQCHQSTGYCWCVLV
DTGRPIPGTSTRYEAPECDSAARSRSSDVEDPFQGRELPGCPEGKKLEFITSLLDALTTD
MVHAINSPAPSGGGRFVEPDPSHTLEERVVHWYFAQLDNNGSHDINKKELKPFKRYLKKK
AKPKKCSRKFSDYCDLNKDRAISLQELKGCLGVSKEGRSTTSGNHGTRQATKLFKGFLC
Download sequence
Identical sequences H3CGF0
ENSTNIP00000007328 ENSTNIP00000007328 99883.ENSTNIP00000007328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]