SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007704 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007704
Domain Number 1 Region: 551-704
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.65e-31
Family MAM domain 0.00094
Further Details:      
 
Domain Number 2 Region: 866-1027
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-27
Family MAM domain 0.0019
Further Details:      
 
Domain Number 3 Region: 706-862
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.91e-27
Family MAM domain 0.0005
Further Details:      
 
Domain Number 4 Region: 162-325
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.7e-25
Family MAM domain 0.024
Further Details:      
 
Domain Number 5 Region: 10-111
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000649
Family MAM domain 0.0056
Further Details:      
 
Domain Number 6 Region: 385-541
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000019
Family MAM domain 0.042
Further Details:      
 
Domain Number 7 Region: 132-162
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.002
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000007704
Domain Number - Region: 362-394
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00301
Family LDL receptor-like module 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007704   Gene: ENSTNIG00000005038   Transcript: ENSTNIT00000007865
Sequence length 1039
Comment pep:novel chromosome:TETRAODON8:Un_random:74076462:74083714:-1 gene:ENSTNIG00000005038 transcript:ENSTNIT00000007865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAVTEVESQERSMAVFISPVIRESAATCRLRLRYFLWNSGLGSTPLWASVVHQDSQEAVV
WRPEATSVRSWREGTVFLSRIPSAFQILFHSHRSRGQRGDVAIDQLEFLDCALPLLSLPT
SSVPSPGEECAVVRCNNGACVEERQVCDGTDDCGDGTDELDCGASCDFEEGLCEWNLASL
SLLKWVRTSQKNISLSDPLKGPGRDHSTNSVTGHFLYVTVPETGLTNDWASFQSHLLEPT
NSSHPCKMVMYTHQFGPRSGGLTVLVADGEIYPVWERGGALGDLWVKAELEIVTSSDFHI
LIMAAIRDFAYGGVAIDSIRLSPDCRKSSVYHPSSCSTLFFFPPSQLANAPLSKFPRPPK
DPCTEADKMCDFTPDCQQEEDEAKCGAWDFSYPEGSSGWTDTSIGSQGWDLYKNSTTKDL
SCAVEEYLHVVNAPGQQLTGAQTRTPLLGPTGPACTLRSFFFFYVGAAGELSVRVIDSML
GTQPKLWEFTGKTGTDEEAWRQVNLTIGARKHRFQLAFEAQAIKISPQTMIKVTNVGFSD
CNVGYIPFRPTGLSCNFEDNLCGWYQDNSDNFDWTLFNGMDHTIGIGRSLTVDVWSPSLR
GLSGRLISYSQPPRSAESCLSFFYKLYGPNTGALNVKLTDTLHFEKLLWTRSGAHCNLWH
EAHCPVPAQITPFQRFQLIFEVVRSGFDGRVAIDDVSFVGRKCTVPRMCSFEEQLCGFTT
SGWHRRNGRTSAAIGPETDHTLETPVGFYMLANTASYSLPAGQTAVLVSPVHPGNAKIEC
VHFWYNTGGETPGSLTLYLTFLNGRRVKIFSNSLNQGDTWRHGSGNISSGLQDWQLEFEV
TGAGGEESYIAVDDIVLSAHPCQAQGSTCTLERGMCTWSNTQNIRLDTLDWELTSSQLEK
HYPVPHEDHTLGTERGHFLFLPSSNRTASNGNAYLLSPHLPPTKGTCLKFWAFMPHSYVK
KKKPCSLSINTANSKLKVWTITEGQSNEWKHFEINIVSPQEYQIAFEGIKGVSGFVALDD
IKYTPGVNCDNQLVDPKPG
Download sequence
Identical sequences H3CHH6
99883.ENSTNIP00000007704 ENSTNIP00000007704 ENSTNIP00000007704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]