SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007752 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007752
Domain Number 1 Region: 183-306
Classification Level Classification E-value
Superfamily PH domain-like 8.91e-26
Family Third domain of FERM 0.0071
Further Details:      
 
Domain Number 2 Region: 84-181
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-22
Family Second domain of FERM 0.003
Further Details:      
 
Domain Number 3 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.47e-20
Family First domain of FERM 0.0028
Further Details:      
 
Domain Number 4 Region: 380-429
Classification Level Classification E-value
Superfamily RING/U-box 0.0000045
Family RING finger domain, C3HC4 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007752   Gene: ENSTNIG00000005087   Transcript: ENSTNIT00000007913
Sequence length 474
Comment pep:novel chromosome:TETRAODON8:21:1517594:1527685:-1 gene:ENSTNIG00000005087 transcript:ENSTNIT00000007913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCYVTRPDSVVMEVEVDAKANGEDCLNKVCRKLGIIEVDYFGLQFTGAKGENLWLNLRN
RICQQMDHVAPCRLRLRVKFFVEPHLILQEQTRHIFFTHVKEDLHHGHLRMCSDQAVELS
ALLAQAEFGDYNQNTARYWYSELCGEEPSVDAIDSIISRHQTLAGLSQASVEYQALQLVA
ALEHYGVEWHWARDASSQRLAIGVGPEGIAVCKEDFSLVNRVSYPVIQIATQSGKTVYLT
VTKETSDSVVLLFKLISNRAASGLYRAITETHAFYRCDTVTSAVMMQYSRDFKGHLASLF
LNENINLGKKYVFDIRRTAKEVYDHARRALYNSGIVDLVSRGGGEGEGPSPPRSPCRDEG
PDCGGCQQSRALQERLRKLREALLCMLCCEEEMDAAFCPCGHMVCCQSCASQLQLCPVCR
SEVDHVQHVYLPTCTSLLNLTLTDNHQHRAAIPAAIHRDLASPLSEYEPKVYHT
Download sequence
Identical sequences H3CHM4
99883.ENSTNIP00000007752 ENSTNIP00000007752 ENSTNIP00000007752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]