SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008308 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008308
Domain Number 1 Region: 832-971
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 5.27e-51
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.0000554
Further Details:      
 
Domain Number 2 Region: 570-817
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.4e-32
Family Extended AAA-ATPase domain 0.0000115
Further Details:      
 
Domain Number 3 Region: 401-479
Classification Level Classification E-value
Superfamily BRCT domain 2.76e-19
Family DNA ligase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008308   Gene: ENSTNIG00000005606   Transcript: ENSTNIT00000008474
Sequence length 1133
Comment pep:novel chromosome:TETRAODON8:18:332519:339055:1 gene:ENSTNIG00000005606 transcript:ENSTNIT00000008474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDIRLFFQPSSSKPAAQRSPPNGGVRAEKKKPFSSDEDVGKKSKNAPKVKSTKAEEKCKN
IEKKRKKITVIDSDSEDEDLVKKSKKFPKGKRTTSRIKSPPRNDPVQYISETDSDDDTFH
TKKEIAKAKSNGSTKSAKTDADGPQRGARAGVKSPVKPASHPKRTPTSVLDYFGNAAVQR
SEKKLVASAKRKVPTQDGGDLMGGREMDDDMELEKQIHDDEEFARTLAMLDEEPQAKRSL
KDTCDGRCLFYSIPSVPLQARHGPEEKTATAPTQSCSDSAVWPKQSVKKRPEDHRGSERE
WHVTQEWMKKRDEERDERQQSKMMSSPTKIQISPKKEPITSPKKGKSEATANRVNISPRK
PESAIRSPDDAEKRKVNATAYRNYLNRDGPRALGKEIPQGAENCLEGCVFVLTGVLESME
RDETKSLIERYGGKVTGNISKKTTYLVQGRDCGVSKLEKAESLGTKILDEDGLLELIRTK
PGKKSKYEIAAEAESKVSKTRTPSKASKSTPTTQKISPSKDTSRTREGRTPPGRGSAQTA
RRELSLSSSNSSSSPAEAAVPRRTAGDEALLWVDKYRPRSLKAVIGQQGEQSCANKLLRW
LQNWHRHHGGGTLKAPAKTGKFGGKDDGSGYKAALLSGPPGVGKTTTASLVCEELGFSYV
EMNASCTRSKNSLKEVVAESVNNTSIENFYRGTSQTVSSKHVLIMDEVDGMAGNEDRGGI
QELIALIKGSKIPIICMCNDRNHMKIRSLANYCFDLRFQRPRVEQIKAAMMSIAFKEGIK
NLAPALNEIILASNQDVRQVLHNLSMWTATDKVMSYDRCKADAAKARKDMKIGPFEVCRK
VFSAGEEAAHMSLMDKSDLFFHDYSLAPLFVQENYLNVRPAAAGGNLKSHLMLLSKTADS
ISDGDLVDRRIRSGQNWSLLPTQAIYASVLPGELMRGYMSQFPSFPSWLGKNSSAGKHSR
IVQELTAHMGLKTMSSRQAVNLDYLHYLRQALLRPLQRSGAEGAGEAVQILDDYQLIKED
VDSMMEISVWGNQADPYSKLDSKVKAAFTRAYNKEVHLTPYALLAVKKSRRGGGGESEGG
GEDVDSQPQESEDEGESLQTDAMIKQKKTKVTRQTKEKEDSGKRRGKAKAKTR
Download sequence
Identical sequences H3CJ79
ENSTNIP00000008308 99883.ENSTNIP00000008308 ENSTNIP00000008308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]