SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008517 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008517
Domain Number 1 Region: 132-441
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.5e-104
Family Transglutaminase core 0.0000000088
Further Details:      
 
Domain Number 2 Region: 2-131
Classification Level Classification E-value
Superfamily E set domains 4.55e-34
Family Transglutaminase N-terminal domain 0.00017
Further Details:      
 
Domain Number 3 Region: 567-661
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.66e-21
Family Transglutaminase, two C-terminal domains 0.00054
Further Details:      
 
Domain Number 4 Region: 455-556
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.28e-17
Family Transglutaminase, two C-terminal domains 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008517   Gene: ENSTNIG00000005799   Transcript: ENSTNIT00000008685
Sequence length 662
Comment pep:novel chromosome:TETRAODON8:Un_random:80958844:80962414:-1 gene:ENSTNIG00000005799 transcript:ENSTNIT00000008685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSINKPAHMTTDYHTELLVVRRGFEMFFKVTFSQPLTEADDFQMEFLIGKSPSSTKGSMV
TVAFNSQSGVWPGQIVEMQGSVVTVSVTPATDAIVGRYRVYVNILTASGVIRSPKNSNTD
LYLLFNAWCPDDVVFMANGSERNEYVLNDSGTIFVGSADDVSQRPWLYGTWYEDGILDAC
IYIMDAAKMPIWDRSKVLKVIRVGSAMINAQDDNGVLVGNWSQDFSMGTAPTAWTGSVKI
LLQYFTTGVPVCYAQCWVFAGVFNTFLRCLGIPARVVTNFNSAHDNTGNLKTDLIFHADG
TPDSDSTTDSIWNYHVWNEVWMVRYDLPDGLAGWQVVDATPQETSDGYFRCGPASVNAIR
SGYVYHPFDTSFVFAEVNSDIVYYKKDKYGNLTPYNVDTTHVGRCIYTKALSGSGPVDIT
HTYKHPEGSAEDKQAMAQAEQFGVQRDHSDIPEQPVKVTMQAKEVFLEQDIVLDIGFRND
GVLDTVVNAHLSGSVIYYTGAVANNLEDRKLTLTIMGNTVEHVKVMVPAHEYMPVLGSQL
SLRFIVSLDADSQSAAAMKVVNLKTKNLDITISGVAVVDKDMYVTVTFTNRYSFALYNVF
MYMEGSGVIDIKSHFNHVIHPGGTVTWKEACRPRLHGLRGIVAVLYCSSLCLYGYVVVNV
SP
Download sequence
Identical sequences H3CJT8
ENSTNIP00000008517 ENSTNIP00000008517 99883.ENSTNIP00000008517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]