SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008768 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008768
Domain Number 1 Region: 50-193
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000043
Family Phosphotyrosine-binding domain (PTB) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008768   Gene: ENSTNIG00000006025   Transcript: ENSTNIT00000008938
Sequence length 198
Comment pep:novel chromosome:TETRAODON8:14:9594026:9596491:-1 gene:ENSTNIG00000006025 transcript:ENSTNIT00000008938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRKVKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGNSSSEACAE
FRVKYVGAIEKLEFNLSRTLQEPLDLIGYIDAAQQDGKLPFVPGDREMILGVSKYGVKVA
SLDQCDVLHRHPLYLIVRMLCYDDGLGAGKNLLALKTTDAQQEECSIWVYQCSSSEQAQS
ICKVLSASFDCALSSDKS
Download sequence
Identical sequences H3CKI9
99883.ENSTNIP00000008768 99883.ENSTNIP00000020450 ENSTNIP00000008768 ENSTNIP00000020450 ENSTNIP00000008768 ENSTNIP00000020450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]