SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008790 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008790
Domain Number 1 Region: 121-223
Classification Level Classification E-value
Superfamily Immunoglobulin 1.04e-18
Family I set domains 0.0066
Further Details:      
 
Domain Number 2 Region: 4-91
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000141
Family Growth factor receptor domain 0.0022
Further Details:      
 
Domain Number 3 Region: 81-124
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000762
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008790   Gene: ENSTNIG00000006047   Transcript: ENSTNIT00000008960
Sequence length 260
Comment pep:novel chromosome:TETRAODON8:12:12441247:12442350:-1 gene:ENSTNIG00000006047 transcript:ENSTNIT00000008960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAEGCAPCEPELCPQTRGCRAGLVPDRCGCCRECGNLEGQACDAGPRSVYFGLCGTGLRC
QADPRPAGRRAEEEDDEEEQVCVCAQMPVCGTDDVTYMNACQFREVAFSRPELRTRGRGP
CRTAPIIKVPPLSQVKAEGGVCVFLCEVFAFPMALVEWRKEGQDVVLPGDDPHVSVQSRG
GPLKFELSSWLQIEGAGPEDSGTYRCIARNSQGSASASAVLGILGADRLTLGLMLMMSPP
PSLCPLSPVPLSTEELSSYL
Download sequence
Identical sequences H3CKL1
99883.ENSTNIP00000008790 ENSTNIP00000008790 ENSTNIP00000008790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]