SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008872 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008872
Domain Number 1 Region: 1304-1437
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-32
Family Cadherin 0.00074
Further Details:      
 
Domain Number 2 Region: 1811-2025
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-32
Family Laminin G-like module 0.0046
Further Details:      
 
Domain Number 3 Region: 2051-2246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.17e-27
Family Laminin G-like module 0.0096
Further Details:      
 
Domain Number 4 Region: 224-333
Classification Level Classification E-value
Superfamily Cadherin-like 5e-25
Family Cadherin 0.0017
Further Details:      
 
Domain Number 5 Region: 543-669
Classification Level Classification E-value
Superfamily Cadherin-like 7.59e-25
Family Cadherin 0.0071
Further Details:      
 
Domain Number 6 Region: 875-975
Classification Level Classification E-value
Superfamily Cadherin-like 1.17e-24
Family Cadherin 0.001
Further Details:      
 
Domain Number 7 Region: 978-1091
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-24
Family Cadherin 0.00077
Further Details:      
 
Domain Number 8 Region: 760-874
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-23
Family Cadherin 0.00078
Further Details:      
 
Domain Number 9 Region: 439-547
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-23
Family Cadherin 0.0019
Further Details:      
 
Domain Number 10 Region: 1084-1199
Classification Level Classification E-value
Superfamily Cadherin-like 5.63e-22
Family Cadherin 0.00039
Further Details:      
 
Domain Number 11 Region: 1202-1316
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-21
Family Cadherin 0.0011
Further Details:      
 
Domain Number 12 Region: 326-448
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-19
Family Cadherin 0.0014
Further Details:      
 
Domain Number 13 Region: 1415-1529
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000685
Family Cadherin 0.0022
Further Details:      
 
Domain Number 14 Region: 651-767
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000714
Family Cadherin 0.0026
Further Details:      
 
Domain Number 15 Region: 132-228
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000271
Family Cadherin 0.0032
Further Details:      
 
Domain Number 16 Region: 1525-1625
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000681
Family Cadherin 0.05
Further Details:      
 
Domain Number 17 Region: 37-118
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000457
Family Cadherin 0.0078
Further Details:      
 
Domain Number 18 Region: 2291-2328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000503
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000008872
Domain Number - Region: 2247-2279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00998
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008872   Gene: ENSTNIG00000012970   Transcript: ENSTNIT00000009043
Sequence length 2565
Comment pep:novel chromosome:TETRAODON8:Un_random:34351844:34379172:1 gene:ENSTNIG00000012970 transcript:ENSTNIT00000009043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMHRGGGGIVRGEGWYLCRVTLATPSQAALQWTMFPRPYLAAVDPDATPGSVVYRLSARQ
PEGTLGSAQFFLLDGKAGGAACFEVDRRSGEIRTTGRPLTPSKEYLLQVEAVDWQGRRGP
GATVAVLAGQRPPQFTNATYNLDLPEDTSVGQPVAAVTAVSFQKKGLAYMLLVNPGGVFS
VHQDSGELSLTRPLDYESGPNLHLLQVRASESDTGLTAVAEVVVQVTDQNDCTPEFLHAI
YSRDGVPESVPAGTSLLQVVARDCDSGLNSQLSYLVQSADFDVTPGGVVNPARRLDYERP
NHVYEFVVVAVDAGTPPRTGTASVRIRVANSNDEAPVFSQSVYKTFLSEDAGPDTLVAIV
HANDPDGDGVSYAITGGNEDSNFLLDKQKGGIIKLRRSPPPRLRGPQYTLNITATDDNAS
GGPFPLSSSAQVIVGINDVNNNKPVFLECHNYSQRAVVLENQPPGTGVLRVQAQDADLGV
NGQVKYGIMHRDGVSSGFHIDPDAGYITTTVSFDRERQREFTLSVTATDQADEPLIGICQ
ITVLVADQNDNEPKFENSRYQYFLREDTPVGTSFLRAAAHDDDQGSNAAISYSLSNQKPA
YLHINPSTGWIYVSQPISQTSRIVRQIVASDGGNRSSSVELTVFITNVHNQPPQWDQPEY
WVTVPENTVRDAKIVTIKATSPLGDPRVTYDLEEGQVPETNMPVRFYVKPNRADGSASIL
VAENLDFETTGFFTLRVRVQNVASVPLASFTTVYVNVTDVNDNVPFFLSSTYEATVPEGA
QTGTSVAQVSAADLDSGPHGTVRYLILRDDSGDWRFFDIDSLSGAIVSRASFDREQKASY
LLEVQSLDGSESARPGQQGQPNTDLAYVRIFVADVNDNAPAFAQSLYEVSVEEDKEVGFV
IITVTANDEDEGANAKLRYQIAAGNSMGAFDVEPEVGTIFVARPLDYEAERRYQLRLVAS
DGKWENETLVVVEVLNRNDEAPVFSQSQYHAAVTEELSQLPVLILQVSATDPDQEADQGA
LRYSLHGQGAGGEFTVDQRSGSIYAHRRLDREERPTWRFLVLATDEGGAGLTGFADVLLE
VRDVNDNAPFFPCPALQAEGCFVGRVAENSPADTSVMEMRATDLDDPNVGANAILTYSII
QNVRNQINLNLFSINGATGTIYTVLRSLDREEAERHLVVVEARDGEGLAGTGTATIIVSD
VNDHAPVFTQRLYSAQVTEDLEVGSQVLVVSAMDQDEGQNAAVTFSIVGGDEDRKFFLET
DRVNRRGVIRLQKKVDFEKPQERVFNLTVKAEDSDFFSLSSCLVRVEDANDHAPVFSPQF
YEAAALSEDTAAGTIVTQVTASDADSGQNGRLSYSISRQSDPLGQFLVDQSGWVLLAGSL
DREKTSQHRILLLATDAGTPALTGTAVLIVTVLDVNDNGPEFEAAYRPMVWENAAAPQTV
PMNDTSLLLHARDRDTPANSAPFSIRLLELTPDAASFNLTDYGNGSAALTALRTFDRERQ
KQYLLAVLMSDSGSPPASSTSTLTVVIGDRNDHAHSAGHSRFIVYGCKGFFPATVLGQVG
SPDPDDWSQKVYRWEGRAPRWFGLNQTSGQLSIREGVPPGSYHLQVRVSDPTWPDVTSTA
QVEVRELQREALRNAASVRLNNLTAEQFFSSRRGQKSLSARFGEALAELCTQPEDVQVFS
VAEAGGRTGAGRALSVWFVRGSPFHKTEKLHGYVAAGRAELEAMLGVAISQVGVDDCPST
DCSRAGGCSSDVSFSQSPVALGAGEVSLVSLSASLAARCGCRSREAVRMPCAAYAANPCL
NGGSCLDGPLGHRCQCPPMFDGPECQQTRRGFGGGGYAWFPPLRPCFRSRVSLEFLAESA
DGLLLYDGPGSAHPGEPQDFVAIELKDGVPVLSVDHGSGTLTLQLRPAASLADRRWHRLD
VSSDGKAVDFVLDQCDGATVDEREAAASSRVDESSCRAAGETPGDQRYLDVFQPLQLGGV
KETSPGARYHGFSGCIRNLVVDSQVYDLASPGESVDSWAGCRLTDGACVSGAGPSCGPRG
SCVADWGSFSCHCGPGYAGLKCDAAVPEFSFGSGSLLRLGLRGGGSSRHTSVQLLVRTRA
PSGTLLAASSPSAREYVVLEVSEGHLSVRADLGDGAHALRLTAHRLDMGQWVLVSLRRHD
NLFTLQLEQGGASREVQARLGSHRKMVVDPGSVTVGNGPQAANASRLSGSGCLRDVRFNG
QLLPLDGQDRDLVAVLERRGIVAGCPSDACSAGPCSSPLRCVDLWRKHQCRCPAGQVTLT
DASGQQSCRPSPCGPASCHNGGVCQATSADSFRCRCQEGFRGQRCELGQVRGQQLAALSP
SSILAVSMCLLLFLAVLVAVTVWNQKGSRSKFRKRGVYHIPAEQQSWEDVRENILNYNEE
GGGEQDQRGYDITELKRPLCSSLSQSSSCTTAPLIKSSPGSQEDVHPPGSSGGCPAPYLS
VQPPGAYADHAAAHARFQTYVSRIVWEADHDCQAFPPDSYHVWCVEGSGSPAGSLSSLGS
VASRSNGPHGEEEEEEGPVRQRLSDWGPKFQVLSDMYERPRRART
Download sequence
Identical sequences H3CKU3
ENSTNIP00000008872 99883.ENSTNIP00000008872 ENSTNIP00000008872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]