SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008927 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008927
Domain Number 1 Region: 93-163
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000157
Family SAM (sterile alpha motif) domain 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000008927
Domain Number - Region: 40-74
Classification Level Classification E-value
Superfamily SH3-domain 0.000781
Family SH3-domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008927   Gene: ENSTNIG00000006179   Transcript: ENSTNIT00000009098
Sequence length 201
Comment pep:novel chromosome:TETRAODON8:Un_random:19223245:19225249:-1 gene:ENSTNIG00000006179 transcript:ENSTNIT00000009098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGFCGRARVHTDYDPSPYDTESLKLKVTCQRLTTVGPPRIGDVISIISRPPMGIWTGLLN
NKVGNFKFIYVDVLLEEEEEEEEEEEEEEEEADKLRPPPPPAVLELLQILNLEDYASALL
PLGRQTAEDPPNPQRKPLMELSRQDAERRCRLLAAAEHLRAGDRRAWKERPPSRHVQEED
SDCPRDSGCFISSEGLDSKEE
Download sequence
Identical sequences Q4SW21
ENSTNIP00000008927 ENSTNIP00000008927 99883.ENSTNIP00000008927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]