SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009105 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009105
Domain Number 1 Region: 26-131
Classification Level Classification E-value
Superfamily E set domains 0.00000000407
Family Filamin repeat (rod domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009105   Gene: ENSTNIG00000006344   Transcript: ENSTNIT00000009276
Sequence length 506
Comment pep:novel chromosome:TETRAODON8:13:990935:994889:-1 gene:ENSTNIG00000006344 transcript:ENSTNIT00000009276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLLVLLQTCYLLISIGFLVCCGGRIRPERCFVAGPGLHPDVVLPVRYFVIQAVDSNGENL
TLSPVKMSRRLQVQISPLKKQEHIRIHVPPPLDRQDGSFLVRYRLYGTVQGGLKVEVHHQ
GVHVAESPYSLHGPVYHEYCDCPEGDASLWESAMRCPAEEPQILKDFSSFPAIDLRRLRQ
EVPRRFANRGGLVHYAVVANRLYRRTLGKYTDFKMFSDEMLLSLTRKVRVPDVEFYINVG
DWPLETRATDALPILSWCGSTDTRDIVLPTYDVTHSTLETMRGVTNDLLSVQGNTGPPWM
NKTARAFFRGRDSREERLHLVSISKKNPELLDAGITAWFFFRDEEKRVGKAPLVGFFDFF
KHKYQVNVDGTVAAYRFPYLLLGNSLVLKQDSPYYEFFYGHLEAGTHYLPVKRDLSDLLD
QIKWAKENDGRAEKMAAAGQALARELLRPGRLYCYYYRVLRAYAERQTGRPTRHPDMEAV
PQPDDPAAACACARALREDSEDKDEL
Download sequence
Identical sequences H3CLH6
99883.ENSTNIP00000009105 ENSTNIP00000009105 ENSTNIP00000009105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]