SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009292 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009292
Domain Number 1 Region: 65-131
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 6.24e-16
Family Ovomucoid domain III-like 0.005
Further Details:      
 
Domain Number 2 Region: 163-224
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000277
Family Ovomucoid domain III-like 0.0072
Further Details:      
 
Domain Number 3 Region: 256-295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000558
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009292   Gene: ENSTNIG00000006521   Transcript: ENSTNIT00000009463
Sequence length 363
Comment pep:novel chromosome:TETRAODON8:4:3856915:3859851:-1 gene:ENSTNIG00000006521 transcript:ENSTNIT00000009463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDVTSSNMVPEPRFSCSWWVLLVLLLHAVRGSFPRSGGAGGPACGPGRSGDCPDLSEKKS
DLRVCDAGTCRYGGTCLENGGDIKCACLFQCSKKYVPVCGSNGDTYQNECFLNRAACKKQ
RAITVLSDGACYHDGGSGSADGDDDGSGHSRIKLSKMWHLQVCERECDEDSEDVLCMCNI
VCNGHNDNPVCGSDSVTYDTPCHVREASCLKQQKIDIRHVGRCQDKTRKDGGPKPKPDIN
AVFTPGDGEAFGDGLGPCPQNYEHFCEHGECEMRQNLPTCSRCESSYGGPQCDQLLDFNV
LYVVPSGQKLHYVLIAAIIGAVQIAIIVAVVMCFTRRCNRTKRGRRQKQHLGHFSSGTSS
RMM
Download sequence
Identical sequences H3CM12
ENSTNIP00000009292 ENSTNIP00000009292 99883.ENSTNIP00000009292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]