SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009536 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009536
Domain Number 1 Region: 330-505,561-590
Classification Level Classification E-value
Superfamily Kelch motif 1.83e-29
Family Kelch motif 0.0018
Further Details:      
 
Domain Number 2 Region: 36-168
Classification Level Classification E-value
Superfamily POZ domain 8.24e-26
Family BTB/POZ domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009536   Gene: ENSTNIG00000006751   Transcript: ENSTNIT00000009711
Sequence length 594
Comment pep:novel chromosome:TETRAODON8:Un_random:88015991:88017888:1 gene:ENSTNIG00000006751 transcript:ENSTNIT00000009711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAPNPEDPARSSATPTPSALAGDGDAEEAEDFTSSSHCSELSRRQNEQRKQGLFCDV
TLVFSSGVANGSVQSCEFSAHRSVLAAATDYFTPLLGGQFSESLSGRVEMKEWSSELGPD
PDTVESVIQYMYTGEIRVSTCNVHEVLELADRFLLVQLKDFCGEFLKKKLSLTNCMAVHS
LAHMYTLDQLALRAADMIRRNFHKVIQDDEFYTLPFHLVHNWLSDAEITVDSEEVLFEAV
VKWVQKNSEERSRYFEELFRLLRLPQIKPTYLARVVKNERLVAGNEACLRLVSEAVEGHA
IRFENLKSADMEFWSSHMASFQPRFGQNMDVIMVVGGVSEGGDYLSECVGYFIYEDRWVN
LPHIHNHLDGHAIAPTESHVYVAGSMEPGFAKTVERYNPNRNTWEQVSNLTTRKHSFGLT
CIKDVLYSIGGHGNFSPGFKDVSVYEPEQDKWHNLESAPKILRDVKAVTVEDRYVYVTAR
TPVDTDNEDGLKTVTTRYDTESRQWQDVDSLPLVDNYCVFQMAVASTNFYHTASCCPKSY
PLRDELAKQKISVRISDEILESLPPEVTSIEGAAICHFNEDVFIIGGWKNSDDV
Download sequence
Identical sequences H3CMQ5
99883.ENSTNIP00000009536 ENSTNIP00000009536 ENSTNIP00000009536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]