SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010712 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010712
Domain Number 1 Region: 50-784
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.35e-255
Family Motor proteins 0.000000000263
Further Details:      
 
Domain Number 2 Region: 1876-1992
Classification Level Classification E-value
Superfamily Second domain of FERM 6.54e-18
Family Second domain of FERM 0.0038
Further Details:      
 
Domain Number 3 Region: 1993-2083
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000738
Family Third domain of FERM 0.058
Further Details:      
 
Domain Number 4 Region: 1176-1279
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000502
Family First domain of FERM 0.069
Further Details:      
 
Domain Number 5 Region: 1271-1382
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000576
Family Second domain of FERM 0.0052
Further Details:      
 
Domain Number 6 Region: 1776-1852
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000362
Family Ras-binding domain, RBD 0.065
Further Details:      
 
Domain Number 7 Region: 794-859
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000186
Family Motor proteins 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010712   Gene: ENSTNIG00000007892   Transcript: ENSTNIT00000010893
Sequence length 2097
Comment pep:novel chromosome:TETRAODON8:15:2632363:2644070:-1 gene:ENSTNIG00000007892 transcript:ENSTNIT00000010893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAMLEKGQWVWVDTDAEVAVGARVKVTPSGQRLLVDDEGKERSLTQELEASLRVMHPTLA
EGVDDMVNLGEMTEAGLLRNLMLRYKQGVIYTYIGSVLVAVNPYQDFPIYTSEQVKLYQG
GNLEELPPHIYALAESCYSRMTRHLQNQCCIISGESGAGKTESTKLILRYLAAVSSEMSK
RRVERLVLESNPILEAFGNAKTTRNDNSSRFGKYLEIFFNEEGVIEGARMEQYLLEKSRV
CHQALGERNYHIFYCMLAGITAEEKKALTLSDPGDYMFLTKGSCIQCEGRDDAAIYKHVR
SAMELFFSESQCQEIFRLLAAILHLGNICFEGNTRDNLETCHVSKSKHFSIAASVLEVRK
SLLESSLTSRSIMTMTESVSKPLSAAQASDCRDAFVKAIYDKLFIWIVGKINSVIYRNLA
KSPKSSPLSIGLLDIFGFENFYRNSFEQLFINFANEKLQQFFVGHIFKREQEEYRREGVA
WTSVRFHDNQDVLDLLALKACNLLSLIDEESQFPKGSDSSMLRKMNQHHAENRNYVASKR
EGDTDFGIHHFAGAVFYDSRGFLEKNRDAVSLDLIKMVARTSPSHVGDLLRLPCRPTADG
SKQVPTLSGQFRQSLDSLLKALSACQPFFIRCFKPNDKKQPKVFDRNLCMHQLKCFGLMD
TVHIRKLGYPIRHSLEYFLNRYRVLLDRTACDPKTSTTAACCEAICRSVIRDKDKWKIGK
TKIFLKDSRDVILEQMRNQRLNRAALVIQTFMKGCKDRMSFLRKRRAAVVLQKGWRSCKR
RQKIHSGFDRLISKIRSQKLRSHYLRQQAAAVTIQRHLRGYLVRKELKQKSSAAVLLQAF
TRGMLARRRTEKIRDQVRSIGNHELIVSDLQQRLLAIAQELEENQPITEQVSRARTPVES
SDSSPVKNNSVFFVKENEITPEEEDDEFSFYRFSALHFQGGATHTHITQRLREPLLHHDD
EGDALACLTVWWLILRFMEDLPEPTSPETSTKGPRLVSRNLPMRQKVLKKNKKKPKVENR
RPTVIPSEVRTDSFWFLSNTSCRQLLMVVLLEEFIEEDNVLMGEGPILDRPLSSLEKVHV
ISEYALSRKGIRDEIYCQICKQLVKNQNKRSQMRGWTLLSLCLGIFPPTDLFMKYLERFL
LQGPNSYGTYCSERLSRIKANGERTELPCWIELQAAKSKAPIDVCVALLDGRSVHLHLDS
ASTSAEVCQVLADKINLQDTYGFSLYISLFDKMCSLGSCRNHVLDAVSQCEQEMRRQGHK
EEDAPWKLSFRKELFAPWHECSEDPVSTDLIYSQVIKGLKSSEYTCEKEDEYVSLAAMHH
HIQFGPACNRDDVQQAVEECIPTELIESRGMTKWIHLIRSAHLQAPERRRDAVKAELVNS
ARQTWALDFSRFYDVTMTSGLPLKTSLFVVAVNWRGIVFLEGKDKKLLEMPYLEIMGVRT
RFLKECFSSSGECGSWSARLTTVRGEFVLKGQKAAAMAALVQEHLEGLRGRSVYALAQQD
SENPTFLRCKRGDLLLVAGTHHWSAGGQLIRATNQRTDSSGVVFRHRLLFLPTLSRPSED
QLVQLATFTADMAAGVVRLLQLNSVKGEETLDPVSLKDFALENFRYYHHRIVFNILKHGG
HKSERLWACSRELLRQPLLKNLMHNSELSNLACNAFTDILQYMGDYPVKNARPPTELTDQ
IFGPATQHNALKDEIYCQIMRQMTGNSYRLSVERGWQLMWLCTGLFSPSPVLLSHARRFL
ESRATNQLAGDCLQRLREMTSKEPRRFPPDLAELEAIQQNSTRVFHKVHFPNETNQTFEV
TSTTTIRELCCSIASQLKLSSADGYGLYLKTRKKMTSLDENQYFFDGTRQASHSLKKAKK
AKEANAAAHLYLVMFKRKLWLNVIPCEDPVADLTFHFPQELPKYLKGRHNCTREDMIHLG
GLLFRIQVGSDGSRSGAIPQMLKELIPVDQINIMSPGDWKKHLFSSYNKQGDITAKEAKI
RFLKVVSTWPTFGCSFFEVKQTCEASFPNAILVVISKQGVGFMDPETKEELDLYPFSRIT
DYHSREEHFHMTLKTVMKGSDFVCETPHAELMEDLLRSYISIIVVLYSKMFNFRINI
Download sequence
Identical sequences H3CR28
ENSTNIP00000010712 ENSTNIP00000010712 99883.ENSTNIP00000010712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]