SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010896 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010896
Domain Number 1 Region: 214-307
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000328
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 
Domain Number 2 Region: 98-162
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000112
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010896   Gene: ENSTNIG00000008072   Transcript: ENSTNIT00000011078
Sequence length 604
Comment pep:novel chromosome:TETRAODON8:8:8791073:8795129:1 gene:ENSTNIG00000008072 transcript:ENSTNIT00000011078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APSRRSKWDQPGPGSGGTGEAEAAPTGALDAAAAVAAKINAMLVAKGKLKPSQIGPPGLP
ERVLSVGKPPAASKAKDDLVVAEVEINDVPITCRNLLTRGQTQDEISKVSGAAVSTRGRY
MTAEEKTKAPPGDRPLYLHVQGQTRQLVDRAVNRIKEIITNGVVKAATASSSASSFSPSA
ASVTVYQQHSPAPPALPPMTQHKSHFQSGMHYVQDKIFVGLEHAVPGFVVKERVEGPGCS
YLQHIQAETGAKVFLRGKGSGCLEPASGREAFEPMYIYISHPKPEGLAAAKTLCENLLQT
VHAEYSRFLSQMNTMMPSQQGFAQPPAVNGVSPQPPYYPTAGYQSGYPLPIPPPQPQSVP
PPYTVPALVPPAAPPGGPPQYPLGLVPVPGPALVPVPAVAPGTLPQTLPPASFPPTSAAP
PKAPPPANPANPPQKRRFTEEVPDEKNSNLLGYQHGPIHMTNLGTGFSLDNREAAGPPPP
SSSGPASERDSRQLMPPPSLPVNGARARVEDRLTAQGPAGIPALLDAAVKRLKTGLVAYA
GDSSDEEDDHSSPKAPGPGNPGNAGAAPLPPSSGWTQGYRCPPPSSSRSKTQPHSQTIPF
WMAR
Download sequence
Identical sequences H3CRL2
99883.ENSTNIP00000010896 ENSTNIP00000010896 ENSTNIP00000010896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]