SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011129 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011129
Domain Number 1 Region: 103-226
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-31
Family C-type lectin domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011129   Gene: ENSTNIG00000008299   Transcript: ENSTNIT00000011311
Sequence length 227
Comment pep:novel chromosome:TETRAODON8:8:8275960:8277557:1 gene:ENSTNIG00000008299 transcript:ENSTNIT00000011311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYIKFCRNYEGDKKDKVSANKSPDSKLCVLLEGEKETEVKKEEKTQVYKKMCAVLSVVCL
ILLLVVIYLSIKSPTGSPACPNPKPVVISQTCSEQTCQALYNFPPKVKLPCEDDWSFFKG
SCYFLSTSRKNWADSQRYCTSKGGSLAVISSPEVQDFLSNQGGLMYWIGLSQSNGIWTWV
NNTVPETGYWAEARQQGDCVFLQTKGNAQKNWIKGNCQQYSYFICQL
Download sequence
Identical sequences H3CS95
99883.ENSTNIP00000011129 ENSTNIP00000011129 ENSTNIP00000011129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]