SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011373 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011373
Domain Number 1 Region: 46-284
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.48e-20
Family Ankyrin repeat 0.003
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011373
Domain Number - Region: 272-348
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0115
Family G proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011373   Gene: ENSTNIG00000008533   Transcript: ENSTNIT00000011555
Sequence length 690
Comment pep:novel chromosome:TETRAODON8:7:2890906:2894997:1 gene:ENSTNIG00000008533 transcript:ENSTNIT00000011555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQEAPKAPMDTDYQEEMEVPPDRIRFNPNFDKIRGEAHPKPDSNIYSITRLFEAVARRDT
DSLANLHRYLHQNMKKLSDPLSADQSHGKSALMKALLHLKDGKNETVELLIRISEQMGDL
DTFVNLAYTSAYYKGQTALHVAIERRSISYVKLLVSKGADVHARACGRFFQPHNGPNFYF
GELPLSLAACTNQPLMVDFLLDQRADPKQRDSYGNTVLHALVVVADNSEENTKFITSMYD
HILVTAARLYPKLKLEDIQNRNGLTPLTMATKTGKSGLFSHILKREFQDSDTKHLSRKFT
EWVYGPVTCFLYDLASVDSYHSGSALEILVYGSDIPNRLEMLQEELLAQLLESKWKRFAS
KMFLSNFIFYLVYLFVFTAVAYNKKDEQLAYTIEHTFWGYLYVSGQLLTALANGYFFIVG
ILDMRKKRLKLQALLIDGYYEILFLLQAFLFLISAVLYLSGQDQYLGFLVMSLALSWVNL
LYFSRGNQHMGVYSIMIQKMILSDILRFLFVYGVFLLGFSAAVVTLLIEPPVRNITSKGR
LLFSSVGPEECVKPTYRNISYTMLELFKFTIGMGDMEFTEDYKYKEVFYVLLIGYIILTY
ILLLNMLIALMNRTVETTAMESTSIWRLQRAITIMDMERRLPCCLRTWLRCGAEKNLGSE
QGDDRRWCFRVEEVNWNKWNIHLGKIDEDP
Download sequence
Identical sequences H3CSY9
ENSTNIP00000011373 99883.ENSTNIP00000011373 ENSTNIP00000011373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]