SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011846 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011846
Domain Number 1 Region: 728-812
Classification Level Classification E-value
Superfamily DEATH domain 1.06e-21
Family DEATH domain, DD 0.0001
Further Details:      
 
Domain Number 2 Region: 53-144
Classification Level Classification E-value
Superfamily Immunoglobulin 3.28e-16
Family I set domains 0.025
Further Details:      
 
Domain Number 3 Region: 143-194
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000327
Family TSP-1 type 1 repeat 0.00039
Further Details:      
 
Domain Number 4 Region: 197-251
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000314
Family TSP-1 type 1 repeat 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011846   Gene: ENSTNIG00000008992   Transcript: ENSTNIT00000012036
Sequence length 818
Comment pep:novel chromosome:TETRAODON8:1:2340125:2372725:1 gene:ENSTNIG00000008992 transcript:ENSTNIT00000012036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPVMQVTIDITRQQVEKIFGLDQYWCQCVAWSTTGTQKSQKAYIRIAYLRKNFEEEPQGK
EVALDQEVLLRCHPPEGVPQAEVEWQRNEDILNPEMDPNFFITADHNLIIRKARMADTGN
YTCVAKNIVARRKSTSAAVIVYVNGGWSTWTTWSSCSAVCGRGWQKRSRSCTNPTPLNGG
SSCDGQNVQKSVCVATCPVDGGWSEWSKWSACGADCSMWRSRECTQPSPGTGGKDCQGLD
LQSLNCTSEQCPQTFQGFLSAHHRRQRQCEVAAVSGAEDVALYVGVVAVALCLTLLLIIV
VLVYRRKKEGLDADVADSSILTTGFQPMGIKPSKPENSHLLTIQPDLTTTTTSYQGTLRS
RHDTTGKFAMTNGTLLDALPNGSHTLHNGKLNSDPSEFVSRLSTQSYFKTLPRDVANASY
GTFNFLGGRLTIPNTGISLLIPPEAIPRGKIYEIYLTVQRREDLRLPLAGCQTLLGPVVS
CGPPGVVLSRSVILSMDHCSDGCLDNWALRLKKQNYEGVWEDVLLMGEELVSEPYYCQLE
AETCRLFSEQLGTFALVGESLHMGAAKRLRLVLFSDAYCSTLEYNIRVYCMDDTEEVFKE
VMQMERQLGGRLIDEPHILLFKDSYHNLRLSIHDMPQAHWRSKLLAGYQEIPFYHIWNGS
QRYLHCTFTLERLSLSTCELTCQLCVWQVEGEGQSFSLDFNIAKDTRAIDAEFMLMDSNA
TALAGPSAFQIPYLIRQKICSSLDAPCPNGADWRMLAQRLKLERHMSFFASKSSPTSVIL
DLWEAQHFHSGNINQLAAVMADIGKQEAMIFLVSDGEC
Download sequence
Identical sequences H3CUB2
ENSTNIP00000011846 ENSTNIP00000011846 99883.ENSTNIP00000011846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]