SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012285 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012285
Domain Number 1 Region: 85-189
Classification Level Classification E-value
Superfamily TAFH domain-like 4.84e-36
Family TAFH domain-like 0.00000217
Further Details:      
 
Domain Number 2 Region: 463-504
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000000802
Family MYND zinc finger 0.00022
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000012285
Domain Number - Region: 397-471
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 0.00275
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012285   Gene: ENSTNIG00000009415   Transcript: ENSTNIT00000012476
Sequence length 552
Comment pep:novel chromosome:TETRAODON8:5:7808780:7819161:1 gene:ENSTNIG00000009415 transcript:ENSTNIT00000012476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDSPADVKTQPRSTPPTMPPPPPAVSQATNRNASFTPTTMLNGSSHSPTSLNGAPSTPN
GFSNGPAMSSTASLSNQQLPPACGARQLCKLKRFLTTLQQFGNDISPEIGERVRSLVLGL
VNSTLTIEDFHSKLHEATNFPLRPFVIPFLKKANLPLLQRELLHCARLAKQTPAQYLAQH
EQLLLDANASSPLDSSEIMLEMNEHGKRRTPDRTKDSSERDGLHPEHLAKRPCTISPSQR
FSPSTGLPAHPPPNHYRLEDMALAHQYRDAYRHSERDRHRQTAVHGARQEEVIDHRLTDR
EWAEEWKHLDNLLNCIMDMVEKTRRSLTVLRRCQEADREEMNHWIRRYSDVEEMKKAPLP
PPSTHHSSSSNTGTPSAEIHRDFLHRPPSGYLPEEIWRKAEEAVNEVKRQAMTELQKAVS
DAERKAHEMISAERSKMERALAEAKRQASEDALTIINQQEDSSESCWNCGRKASETCSGC
NTARYCGSFCQHKDWEKHHHVCGQGLPGLPGGGGVPLGTPSSSSSSSSSASSGAPPTHSE
STPPGPLSLAVQ
Download sequence
Identical sequences H3CVK1
ENSTNIP00000012285 ENSTNIP00000012285 99883.ENSTNIP00000012285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]