SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012949 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012949
Domain Number 1 Region: 320-610
Classification Level Classification E-value
Superfamily Kelch motif 7.32e-73
Family Kelch motif 0.0000171
Further Details:      
 
Domain Number 2 Region: 49-167
Classification Level Classification E-value
Superfamily POZ domain 1.81e-27
Family BTB/POZ domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012949   Gene: ENSTNIG00000010053   Transcript: ENSTNIT00000013141
Sequence length 632
Comment pep:novel chromosome:TETRAODON8:7:5339962:5348222:1 gene:ENSTNIG00000010053 transcript:ENSTNIT00000013141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSERTAFSPLLCRSLVEDDDAHMKVALGYGDMGISAHLQASKTGNTRFFTSNTHSSVVLQ
HFDRPTLKQHGSDLVAGDGDEAFPVHRAMMASSSDYFKAMFTGGMKEQDLMCIKLHGVNR
IGLKKIIDFIYTAKLSLNMENLQDTLEAASFLQILPVLDFCKVFLISGVSLDNCVEVGRI
ANTYNLTEVDKYVNNFILKNFPSLLGTGEFVKLPFERLAFVLSSNSLKHCTELDLFKAAC
RWLRFEEGRMDYASKLMKNIRFPLMNPQELINHVQTVDFMRTDNTCVNLLLEASNYQMMP
YMQPVMQSERTAIRSDSAHLITLGGVLRQQLVVSKELRLFDEKAHEWKALAPMDAPRYQH
GIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRYDPRYNKWMQVACLNEKRTFFHLSALKGH
LYAVGGRNAAGELATVECYNPRTNEWTYVAKMNEPHYGHAGTVYGGYMYISGGITHDTFQ
KELMCFDPDADKWTQKAPMTTVRGLHCMCTVGDRLYVIGGNHFRGTSDYDDVLSCEYYSP
ALDLWPIAAMLRGQSDVGVAVFENKIYVVGGYSWNNRCMVEIVQRYDPEKDEWHKVFDLP
ESLGGIRACTLTVFPPEDISGSPSRESPLAAP
Download sequence
Identical sequences H3CXG4
99883.ENSTNIP00000012949 ENSTNIP00000012949 ENSTNIP00000012949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]