SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013378 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013378
Domain Number 1 Region: 446-655
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-53
Family DBL homology domain (DH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 218-351
Classification Level Classification E-value
Superfamily BRCT domain 1.09e-22
Family DNA ligase 0.037
Further Details:      
 
Domain Number 3 Region: 128-246
Classification Level Classification E-value
Superfamily BRCT domain 1.31e-18
Family DNA ligase 0.041
Further Details:      
 
Domain Number 4 Region: 646-791
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000664
Family Pleckstrin-homology domain (PH domain) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013378   Gene: ENSTNIG00000010470   Transcript: ENSTNIT00000013572
Sequence length 910
Comment pep:novel chromosome:TETRAODON8:Un_random:9315286:9336885:-1 gene:ENSTNIG00000010470 transcript:ENSTNIT00000013572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSSILTLGTARSLLVDSSSCESTRDHVFLGVTCEDGDETLPKVETRVVLVGEAGRNAA
LLKALQAVKAMEVPVVKIRQGNAGGEEKMMIKSIVTMDINTPCLTTDAVEQFADADNTDF
ETVFVLTDFDSPQYHHLYKRDNRIMGPPVVLQCAMKEEPLLFSCRPLYSTTMFNLSLCFT
GFRDKEEIKSLVNLVHHMGGTIRKDFSTKVTHLIAHSTHGEKYRLAVCMGTPILTPSWIH
KAWDKREDIHFHADKEDFRSEFKVPPFQDCVLSFLGFSDEEKVNMEERTLKHGGSYLEVG
DERCTHMVVEENSVKELPSFPSRKLFTVKQEWFWGSIQMDARAGESMYLYEKNDSPAMKK
AVSLLSLSTPNSNRKRRRLKDTLAQLTKETEISPFPPPRKRPSAEHNLSVISLLDISNTP
DTCKALAVSPPVETSRPSKNSAAAVSKQSARWQVSKELYQTESNYVGILNTVLQLFKLPL
EKEGQVGGPILAQEEIKTIFGSIPDIYDVHTRIKGDLEELLSDWSEDRSVGNIILKYSKE
LVKAYPPFVNFFEMSKETIIRCERQKPRFHAFLKINQAKPECGRQTLVELLIRPVQRLPS
VALLLNDIKKHTADENPDKITLEKAIESLKEVMTHINEDKRKTEGQKQIFDVVYEVDGCP
ANLLSSHRSLVYRVETIALGDQPCDRGENVTLFLFNDCLEIARKRHKVINTFKSPMGQTR
PPPPLKHIALMPLSQIRRVLDLQDTEECVNAFALVVRPPTEQENLLFSFQLTGEETVKGA
WLRTLCRHVANTICRADAENLIQCTEPDSVQVSTKDMDSTLSKASRAIKKTSKKVERAFS
FDAVFKQRQRQDLGSLHEEENRERLHGGPRAHSVLSVFGAKAHPSPSMVNLPSMFERKYH
TFSRSSTHLL
Download sequence
Identical sequences H3CYP3
99883.ENSTNIP00000013378 ENSTNIP00000013378 ENSTNIP00000013378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]